KEGG   Cucumis sativus (cucumber): 101217824Help
Entry
101217824         CDS       T02486                                 

Definition
probable MYST-like histone acetyltransferase 1-like
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
csv  Cucumis sativus (cucumber)
Brite
Enzymes [BR:csv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101217824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 448 aa AA seqDB search
MGSIDVQSTSAENGSASASADGRQKSLPTDGMNHTSNDPDGAPPDKPKELGPTKKRLSSM
LPLDVGTRVMCRWRDGKYHPVKVIERRKLQAIGFSDYEYYVHYTEFNRRLDEWVKLDQLD
LDSVETVVDEKVEDKVTGLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATI
ELGRYEIETWYFSPFPPEYNDTTKLYFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYR
CGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYF
SKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLVSYR
GYWTRVLLDILKKHKANISIKELSDMTAIKAEDILNTLQSLELIQYRKGQHVICADPKVL
DRHLKAAGRGGLEVDVSKLIWTPYREQG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgggctccatagacgtccaatcaaccagcgctgaaaatggatccgcctccgcctctgct
gatggtcgtcaaaagtcacttcccaccgacggtatgaaccacacatctaacgacccagac
ggagcgccccctgataagcctaaggaattgggcccgacgaagaaacgtttgtcctccatg
cttcctctggatgtcgggacccgtgtcatgtgccgctggagggacgggaagtaccatccc
gttaaggtcattgaacgtcgcaagttgcaggcaattggttttagtgattacgaatactat
gtccattacaccgagttcaataggagacttgatgagtgggtgaagcttgaccaacttgat
cttgattcggttgagacggttgttgatgagaaagtggaggacaaggtaacaggactgaag
atgacccggcaccagaagcggaagattgacgaaacccatgttgagggccatgaggaactt
gatgctgccagcttgagggagcatgaagaattcacgaaagtgaaaaatattgcaacaatt
gaacttggaagatatgagattgagacatggtatttctccccatttccaccagagtacaat
gacactacaaagctctatttttgtgagttttgtctcaatttcatgaagcgcaaagaacaa
ctccagagacatatgaggaagtgtgatctgaagcatcctcctggtgatgaaatatatcga
tgcggtactttgtcaatgtttgaggttgatggaaaaaagaacaaggtttatgggcagaat
ctgtgttacttagcaaagttatttctggaccacaagactctctactatgatgttgacctt
tttctgttttatgtcctgtgtgagtgtgatgatcgagggtgtcacatggttggatatttt
tcaaaggaaaagcattcagaggaatcctataatttggcatgcattctcacccttcctcct
tatcaaaggaagggctacgggaagttcttaatagcattttcttatgaactctccaagaag
gaaggtaaagttggcactcctgaaagacctctttcagatcttgggttggtgagctacaga
ggatactggaccagagttcttttggacatcttgaaaaagcacaaggccaatatctcgatc
aaggagctaagtgacatgacagctatcaaagccgaagatattttgaacacacttcaaagc
ctggagttgatacaatacaggaaagggcagcatgttatatgtgctgaccctaaggtactg
gatcgtcatctcaaagctgctggtcgtgggggcctagaggtggatgtgagcaaattgatc
tggactccatacagagaacagggttga

DBGET integrated database retrieval system