KEGG   Cucumis sativus (cucumber): 101217891Help
Entry
101217891         CDS       T02486                                 

Definition
protein disulfide-isomerase 5-2-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:csv04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 441 aa AA seqDB search
MRRSSQFLVLFLLSVSSLPSFSFSTSELPLTADGKVLDLDDSNFDLAISSFDYILVDFYA
PWCGHCKRLSPELDAAAPQLARLKEPIVLAKVNADKYTSLAKKYDVDAYPTIKIFMHGVP
VDYYGPRKAELLARYLKKFVAPDVSVLESDSSINEFVEAAGPYFPIYLGFGLDESVISKF
GIKYKKKAWFSVAKGFSEDIMVSYDFDKVPALVSIHPNYNNERSIFYGPFEEQFLEEFIK
QSLFPLVLPINYDTLKLLKDDDRKIALTIVEDEDEDQTKKLINLLKAAASANRDLVFAYV
GAKQWGEFADSFGDKKTTLPKMVIWDGEDDYLMVTGSETIVGNDHASEISKFIEGYREGR
TEKRRVAGPAILGFINSLIGIRTIYIIVIIVAGIMLYQNLTKDDSEYPRVDTSARDQVEQ
TSSSSAPEVERSEYKAGDKED
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcggagatcctcgcaatttctggttcttttcctcctttcagtctcatcactgccatcc
ttttccttttccacctcggagctgccgctcacggcggatggaaaagtgttggacctcgac
gattccaatttcgatctcgccatttcatcatttgattatatattggtcgatttttacgcc
ccatggtgcggccactgcaagcgtctttctccagagttggacgctgctgcacctcagctt
gccagattgaaggagcctatagttctagcaaaagtgaatgctgacaagtatactagtctt
gctaaaaaatatgacgttgatgcctatcctacaatcaagatcttcatgcatggtgtccca
gtagactattacggaccaaggaaagcagagttacttgcccgttatctgaagaaatttgtt
gctccagatgtctcagttcttgagtcagactcatcaattaatgaatttgttgaagctgct
gggccttacttccctatctatttgggttttggtttagatgaatctgttatttctaaattc
ggtatcaagtataagaaaaaggcctggttttcggtggcaaagggtttctcagaggatatc
atggtgtcttatgattttgataaagttcctgctttggtttctatccatccaaattacaac
aatgagcggagcatcttttatggtccttttgaagaacaattcttggaggaattcataaaa
caaagtctgttccctcttgttctgccaataaactacgacactcttaagctactaaaagac
gatgacaggaaaatagcactcacaattgtggaggatgaggatgaggaccagactaagaag
ttgatcaatttattaaaggctgctgcatctgctaatcgtgacttggtgtttgcttacgtt
ggggctaaacagtggggagaatttgccgattcgtttggagacaagaagactaccctgcca
aaaatggtcatttgggacggggaggacgattacttaatggttactggttcagaaaccatc
gtcgggaacgaccatgcatccgaaatctcgaaatttattgaaggatacagagaaggaaga
actgaaaaaagaagagttgcgggtcctgcaattcttggcttcataaattcactaataggc
atcaggacgatatacatcattgtaattattgttgcaggaataatgctttaccaaaacctc
accaaagacgatagcgaatatccaagagtcgatacttctgcacgggatcaggttgagcaa
accagcagcagctctgccccagaggttgaaaggtctgaatacaaggctggtgacaaggaa
gattga

DBGET integrated database retrieval system