KEGG   Cucumis sativus (cucumber): 101218292Help
Entry
101218292         CDS       T02486                                 

Definition
(RefSeq) histone deacetylase 15
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
csv  Cucumis sativus (cucumber)
Brite
Enzymes [BR:csv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101218292
Protein phosphatases and associated proteins [BR:csv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101218292
Messenger RNA biogenesis [BR:csv03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     101218292
Membrane trafficking [BR:csv04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    101218292
Chromosome [BR:csv03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101218292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zinc_ribbon_2 zf-RanBP
Motif
Other DBs
NCBI-GeneID: 101218292
NCBI-ProteinID: XP_004139132
Position
1
AA seq 600 aa AA seqDB search
MVSEALQKRVNGEAEVNLQKQGEQHPRHSLNGRCGKSGSERKSVRSCPDDSCREDNTGVA
SYKDVPSSVDIDMQPDSLRKKTRKQREISFQDMGNNVDIFDDGDDDDDDDSDWEPLQKLR
EIVKWFCTNCTMANLDVAVHCDSCGEHKESAILKHGFFAPSFVQDSNFLKTELEMKRTDK
AMVSQVSTSNSSTAIGFDERMLLHSEVEMKSHPHPERPDRLRAIAASLATAGIFPGKCYP
IPAREITKEELEMVHSLENIQAVEVTSNVISCYFTPDTYANKHSAQAARLAAGLCADLAS
EIVSGRAKNGFALVRPPGHHAGVKQAMGFCLHNNAAVSALAAQAAGAKKVLIVDWDVHHG
NGTQEIFEQNKSVLYISLHRHEFGRFYPGTGAADEVGTMGAEGYCVNVPWSRSGVGDNDY
IFAFKQVVLPIASAFAPDLTIISAGFDAARGDPLGMCDVTPTGYAQMTHLLNTVSGGKLL
VILEGGYNLRSISSSATAVIKVLLGESPECDLDDHLPSSAGMKTVLDVLAIQKNFWPVLE
SSFSKLQSMLEIFATERRGKVKPCKQRRRAVVAPICWRWGRKRLLYHLLKGQIRVRSKGC
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggtttcagaagctcttcaaaagagggtgaatggagaggctgaagtaaatcttcagaag
caaggcgagcaacacccacgtcatagtttaaatggaagatgtggaaaatcaggctctgaa
agaaagagtgttagatcttgtccagatgatagttgtcgagaagataatacaggtgtagct
tcttataaagatgtaccaagcagtgtagatatagatatgcaacctgattctttacgtaag
aagacaagaaaacagagagaaataagcttccaagatatgggtaacaacgtcgacatattt
gatgatggtgatgatgacgatgacgacgatagtgactgggaaccgttacagaaactcagg
gaaatagtgaagtggttctgcaccaattgtaccatggccaaccttgatgttgctgtacac
tgtgactcatgtggcgaacataaagaatctgcaattctcaagcatgggttttttgctcct
tcatttgtacaagattcaaattttttaaagactgagcttgaaatgaaaagaactgataaa
gccatggtttcacaagtatcaacatctaatagttccacggcaataggctttgatgagaga
atgttgctgcattcagaagttgaaatgaagtcacacccacacccagaaagaccggatcgt
ctgagagctattgctgctagcttggctacagctggaatctttcctggaaaatgctatcca
attccagctagagaaattaccaaagaagaacttgagatggttcattccctggagaacatt
caagctgttgaggttacaagcaatgttatctcttgttattttacccctgacacatatgca
aataagcattcggcacaggctgctaggcttgctgcagggttatgtgccgatcttgcttca
gaaatcgtttctggtcgtgccaaaaatggttttgctttggttcgtcctcctggccaccat
gcaggtgttaaacaagccatggggttttgcctccataacaatgcggcagtttctgcattg
gcagctcaggctgctggtgctaagaaggtgttaatagttgattgggatgttcatcatgga
aatggaacacaggaaatatttgagcaaaataaatcggtcttgtatatatctttacatagg
catgagtttggtagattctatcctggaacaggagctgctgatgaggttggcactatggga
gcagaaggatattgtgtaaatgttccttggagtcggtcaggagttggtgataacgattac
atttttgcgtttaagcaagttgtgcttcccatagcttctgcttttgcccctgatctcact
atcatatcagcagggtttgatgctgctaggggtgatccattgggaatgtgtgatgtaact
cctaccgggtatgcacagatgactcatttgttgaataccgtctctggtgggaaactgctt
gttatcctggaaggcggctataatcttcgttccatttcatcttcagctactgcagttatc
aaggtattgctgggtgaaagtcctgaatgtgacttggatgatcacttaccctccagcgct
gggatgaaaacagtattagatgtgcttgcgattcaaaaaaatttctggcctgtgctggaa
tctagcttttcaaaactgcagtcaatgttggagatatttgccaccgaaagaagaggaaaa
gtaaaaccatgtaagcagagaagacgtgctgtggtggctccgatatgttggcgatggggt
cggaagaggctgttgtatcatctactaaaagggcaaatccgtgtaagatcaaagggatgc
taa

DBGET integrated database retrieval system