KEGG   Cucumis sativus (cucumber): 101218839Help
Entry
101218839         CDS       T02486                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
csv  Cucumis sativus (cucumber)
Brite
Enzymes [BR:csv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101218839
Transfer RNA biogenesis [BR:csv03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    101218839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 564 aa AA seqDB search
MATAMVAEPNRKLPRPGRGGFEGHGFSEEEARVRAIAEIVNSMVDLSRKGQNVDLNALKS
AACRKYGLARAPKLVEMIAALPESDRETLLPKLRAKPVRTASGIAVVAVMSKPHRCPHIA
TTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSVD
KVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVAYSEHGAVKCIGMTIETR
PDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVA
HMMPDLPNVGVERDMESFREFFENPSFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPE
QLVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVRT
REAGIQDIHHKIKPDEVELVRRDYMANEGWETFLSYEDVRQDILVGLLRLRRCGRNTTCP
ELLGKCSIVRELHVYGTAVPVHGRDTEKLQHQGYGTLLMEEAERIARHEHRSKKIAVISG
VGTRHYYRKLGYELEGPYMVKNLE
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgcgatggtggcggaaccaaatcggaaactgcctcggccgggccggggcggc
ttcgaaggccatggattttccgaggaagaagctcgagttcgtgctattgctgagattgtc
aactccatggtcgacctttcgcgtaaagggcaaaacgtcgatctgaacgctctcaaatcc
gccgcctgccggaagtatggccttgcacgagcaccaaagctcgttgaaatgatcgcagca
cttccggaatcggaccgcgagaccctactaccgaagcttcgagccaagccggttcgaaca
gcctccggtatcgcagtcgtggccgtgatgtctaagccgcatcgttgccctcatattgct
acgacggggaatatttgtgtgtactgccccggaggacctgattcagactttgagtacagt
actcaatcttacactggatatgagcctacaagcatgcgtgcaattcgtgcaagatacaac
ccatatgtccaggctagaagcaggatagatcagttgaagcgtttgggtcacagtgttgat
aaggttgagttcatcttaatgggtgggactttcatgtcgcttccagctgattatcgtgat
tactttataaggaatcttcatgatgctttgtcagggcatacctctgccaatgttgaagag
gcagttgcctactcagagcatggtgcagttaaatgcataggcatgacgatagaaacgagg
cctgattattgtcttggtcctcacttgagacaaatgctttcttatggttgtacacgacta
gagattggagttcaaagtacatatgaggatgtggctcgagacactaatagagggcatact
gtagctgccgtggctgattgcttttgcttggcaaaggatgctggtttcaaggttgtagca
cacatgatgcctgaccttccaaatgttggggttgagagagacatggagagttttcgcgag
ttctttgaaaacccttcatttagagcagatgggctcaaaatatatccaacactcgtaatc
cgtggaactgggctctatgaactgtggaaaactggcaggtatagaaactatcccccagag
caacttgttgatattgtggcaagaatcctggctatggtaccaccctggacccgagtttat
agagtacaacgggatatcccaatgcctttggtaacttctggcgtagagaaaggaaatctt
cgagagttagctctagctcggatggatgatttgggcttaaaatgccgtgatgttaggact
cgtgaagctggaattcaggacattcaccataagattaaacccgatgaagttgagcttgtt
cgtcgtgattatatggcaaatgaaggctgggaaacgtttctgtcctatgaagatgttcgc
caggacattcttgttggtttgcttcggttgagaagatgtggtcgtaacaccacttgtccc
gaactcctagggaagtgttccattgttcgtgaactccatgtgtatggaactgctgttcca
gttcatggacgtgatacagagaagctacaacaccagggttatggtacgcttttgatggag
gaagcagagcggatagctcgtcatgagcatcgatcaaagaagattgctgttatatcaggc
gttgggacccgccattactatagaaaattaggctatgaacttgaagggccttacatggtg
aaaaaccttgagtga

DBGET integrated database retrieval system