KEGG   Cucumis sativus (cucumber): 101221017Help
Entry
101221017         CDS       T02486                                 

Definition
chalcone--flavonone isomerase-like
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    101221017
Enzymes [BR:csv01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.6  chalcone isomerase
     101221017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 240 aa AA seqDB search
MARLGGLQVETVNFPAEIKPPASANTLFLGGAGVRALEIGGNTVKFTAIGIYLEDKAVPS
LAGKWSGKSAAELMDSVEFFRDVVTGGFEKFTNVTLILPLTGEQYAMKVAENCEAAWKSM
GIYSDEGAEAIQKFIDIFKNENFPPGSSILFTHLPPNTLSISFSKDGSIGEKEEEMVKKI
ENKLLSESVLESIVGKNGVSPAARLSLASRLSHLFNLSQPNISNPFQDPKSEPNRIHLST
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtctaggtggacttcaggtcgagaccgttaactttcccgccgaaatcaagcct
ccggcctccgctaacactctttttctcggcggtgcaggagttagggcattggagatcgga
ggaaatactgtgaaatttactgcgatcggtatttatttggaggacaaagctgtgccgtcg
ctcgccggtaagtggagtggaaagagtgcggcggagttaatggattccgttgagttcttc
agggacgttgtcactgggggtttcgagaagtttacaaatgtgacattaatattgccactc
acgggtgaacaatatgctatgaaagtggcagagaattgtgaagcagcttggaaatccatg
ggaatttatagtgatgaaggagctgaagccattcaaaagttcatcgatatcttcaaaaat
gaaaatttccctcctggctcctccattcttttcacccatttgcctcctaataccttatcg
attagcttttcaaaagatgggagtattggtgaaaaagaagaagagatggtgaaaaaaata
gagaacaaactgcttagtgaatctgttttggagtccattgttggaaaaaatggggtttca
ccagctgcaaggcttagtttggcttcaagattatcccatctcttcaatctatctcaaccc
aacatttccaacccttttcaagatcctaaatccgaaccaaataggatccacttatccaca
tag

DBGET integrated database retrieval system