KEGG   Cucumis sativus (cucumber): 101221066Help
Entry
101221066         CDS       T02486                                 

Definition
protein disulfide-isomerase like 2-2-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:csv00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101221066
Enzymes [BR:csv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101221066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 438 aa AA seqDB search
MRSGQSPILTILLFIFFLRFDLSNALYGPSSPVLQLTPSNFKSKVLNSNGIVLVEFFAPW
CGHCQALTPVWEKAATVLKGVATVAALDADAHKSLAQEYGIKGFPTIKVFAPGKPPVDYQ
GARDVKPIAEFALQQVKALLKERLNGKTTGGGSNEKSEPNASEELNSRNFDELVIKSKDL
WIVEFFAPWCGHCKRLAPEWKKAAKNLKGKVKLGHVDCDAEKSLMSRFNVQGFPTILVFG
ADKYSPITYEGARTASGIESFALDQLETNVAPPEVTELTGSDVMDEKCASAAICFVAFLP
DILDSKAEGRNRYLKQLLSVAEKFRRSPYSYIWAAAGKQPDLEQRVGVGGYGYPALVALN
VKKGAYAPLKSAFELEHIIEFVKEAGRGGKGNLPLESTPEIVKTEPWDGKDGEVIEEDEF
SLEELMGGEDETVTKDEL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtggtcaatcgcccattttaacgatcctgctcttcatcttcttccttcgattc
gatctcagtaacgcactctatggaccatcgtctccagttcttcaacttactccttccaac
ttcaagtccaaggttttgaactcaaatggcatcgttcttgttgagttctttgcaccttgg
tgcggtcattgtcaagccctcacgcctgtatgggagaaagcggctaccgtcttgaaagga
gtggcaacagtagcagcacttgatgcagacgcgcacaagtcacttgctcaggaatatggc
attaaaggattcccaaccataaaagtctttgcacctggaaagcctccggtagactaccaa
ggagctcgggatgttaaaccaattgcagaatttgctttgcagcaggtgaaggctctgtta
aaggaacgtctaaatggaaaaacaactggaggtgggtcaaatgagaaatcagaacctaat
gcttcagaagaattgaattctcgaaactttgatgagttagtgataaaaagtaaagatctc
tggattgtggagttctttgctccttggtgtggacactgtaaacgtttggctccagaatgg
aagaaggctgctaaaaatttgaaggggaaagtgaagttgggtcacgtagattgtgatgct
gagaagtctctcatgagcaggttcaacgtgcaaggattccctaccatcttggtgttcggt
gctgacaagtacagtccaattacgtatgagggtgcaagaacagcatcaggaatcgagtca
tttgctttagaccagctagagacaaatgttgcacccccagaagtgacggagctcactggt
tctgacgtcatggatgagaaatgtgcatcggctgccatttgttttgttgctttcctgccc
gacattttggattccaaggccgaaggaaggaacagatacctcaagcaattgttatcagtt
gccgagaagttcagaagaagtccctacagctatatttgggcagccgccggtaagcaaccc
gatcttgaacagcgtgtgggagttggtggatatgggtaccctgccttggtggctttgaat
gtgaagaaaggagcatatgctccccttaagagtgcattcgagctcgagcatattatcgag
tttgtaaaagaagctggccgtggaggaaaagggaatttgcctctagaaagcactccagaa
attgtgaagacagaaccatgggacggtaaagacggcgaggttatcgaagaagatgagttt
tcgctggaagagcttatgggaggcgaagatgagacagtaactaaagatgagctatga

  All links  
No link information was found.   
DBGET integrated database retrieval system