KEGG   Cucumis sativus (cucumber): 101221066Help
Entry
101221066         CDS       T02486                                 

Definition
protein disulfide-isomerase like 2-2-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:csv04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 438 aa AA seqDB search
MRSGQSPILTILLFIFFLRFDLSNALYGPSSPVLQLTPSNFKSKVLNSNGIVLVEFFAPW
CGHCQALTPVWEKAATVLKGVATVAALDADAHKSLAQEYGIKGFPTIKVFAPGKPPVDYQ
GARDVKPIAEFALQQVKALLKERLNGKTTGGGSNEKSEPNASEELNSRNFDELVIKSKDL
WIVEFFAPWCGHCKRLAPEWKKAAKNLKGKVKLGHVDCDAEKSLMSRFNVQGFPTILVFG
ADKYSPITYEGARTASGIESFALDQLETNVAPPEVTELTGSDVMDEKCASAAICFVAFLP
DILDSKAEGRNRYLKQLLSVAEKFRRSPYSYIWAAAGKQPDLEQRVGVGGYGYPALVALN
VKKGAYAPLKSAFELEHIIEFVKEAGRGGKGNLPLESTPEIVKTEPWDGKDGEVIEEDEF
SLEELMGGEDETVTKDEL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtggtcaatcgcccattttaacgatcctgctcttcatcttcttccttcgattc
gatctcagtaacgcactctatggaccatcgtctccagttcttcaacttactccttccaac
ttcaagtccaaggttttgaactcaaatggcatcgttcttgttgagttctttgcaccttgg
tgcggtcattgtcaagccctcacgcctgtatgggagaaagcggctaccgtcttgaaagga
gtggcaacagtagcagcacttgatgcagacgcgcacaagtcacttgctcaggaatatggc
attaaaggattcccaaccataaaagtctttgcacctggaaagcctccggtagactaccaa
ggagctcgggatgttaaaccaattgcagaatttgctttgcagcaggtgaaggctctgtta
aaggaacgtctaaatggaaaaacaactggaggtgggtcaaatgagaaatcagaacctaat
gcttcagaagaattgaattctcgaaactttgatgagttagtgataaaaagtaaagatctc
tggattgtggagttctttgctccttggtgtggacactgtaaacgtttggctccagaatgg
aagaaggctgctaaaaatttgaaggggaaagtgaagttgggtcacgtagattgtgatgct
gagaagtctctcatgagcaggttcaacgtgcaaggattccctaccatcttggtgttcggt
gctgacaagtacagtccaattacgtatgagggtgcaagaacagcatcaggaatcgagtca
tttgctttagaccagctagagacaaatgttgcacccccagaagtgacggagctcactggt
tctgacgtcatggatgagaaatgtgcatcggctgccatttgttttgttgctttcctgccc
gacattttggattccaaggccgaaggaaggaacagatacctcaagcaattgttatcagtt
gccgagaagttcagaagaagtccctacagctatatttgggcagccgccggtaagcaaccc
gatcttgaacagcgtgtgggagttggtggatatgggtaccctgccttggtggctttgaat
gtgaagaaaggagcatatgctccccttaagagtgcattcgagctcgagcatattatcgag
tttgtaaaagaagctggccgtggaggaaaagggaatttgcctctagaaagcactccagaa
attgtgaagacagaaccatgggacggtaaagacggcgaggttatcgaagaagatgagttt
tcgctggaagagcttatgggaggcgaagatgagacagtaactaaagatgagctatga

DBGET integrated database retrieval system