KEGG   Cucumis sativus (cucumber): 101223111Help
Entry
101223111         CDS       T02486                                 

Definition
histone acetyltransferase type B catalytic subunit-like
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
csv  Cucumis sativus (cucumber)
Brite
Enzymes [BR:csv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101223111
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 464 aa AA seqDB search
MGQKQQLSADPRPDTKKKRRVAFFNIDTGISAKDCIKIYLVCTKEEVGSTDGLCIDPVDL
NSFFDDEDGKIYGYQGLKITVWFSIVSFRAYADIVFDSTSDGGKGITDLKSALQNIFAET
LVDNKDDFLQTFSKDVNFIGSLVADGEVLHPKASSNGKSNDSNFHLQAANSDLEVIRLPM
DNMAGRNLYSHLVPLALLLIDGSSPIDVTDPRWELYVLTQKTNDQLGQTYPTLLGFAALY
RFYHYPDSSRLRLSQILVLPPYQRKGFGRVLLEVLNNVAISENVYDFTIEEPLSQLLQLR
TCIDVKRLRGFGPIQEAVESAVSQFKFGRLSKKVSFPPLLPPSEAIEAVRKSLKITKEQF
LHCWEILIFLGIEPDKHMEDFILAVSSRMRNDLIGESSDAEGKQVVDVPTDYDQEMSFVM
FRSTNNATGVETDESRANQEEQLKKLVDDRVSEIKLIAQKVSAD
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagaagcaacaactctccgctgatccacgccccgacactaagaaaaaacgtcgc
gttgccttcttcaacatcgatactggtatttcagccaaagactgcatcaaaatttatcta
gtttgtacaaaagaggaagtgggaagtacagacggtctctgtattgaccctgttgacttg
aatagcttctttgacgatgaggatggaaagatatatggttaccaaggtttgaagataact
gtatggttcagcattgtctcatttcgtgcctatgcagatattgtttttgatagtacatct
gatggcggtaagggtattacagatctgaagtctgcacttcagaatatatttgctgagact
cttgtggacaacaaagatgacttccttcaaactttttcgaaggatgtcaattttattgga
tcccttgttgcagatggagaagtattacatcccaaagcttcctccaatggaaaatctaat
gattctaattttcatttacaagcagctaattctgatttggaggtcattcgattgcctatg
gacaatatggctggaagaaacctttatagtcacttggtacctcttgctctacttcttatt
gatggcagcagccctatcgatgtaactgatccaagatgggagttgtatgttctcactcag
aagaccaatgatcaactggggcaaacttatcccacattacttggatttgctgccctttat
cgtttctaccactatcccgatagttctcgcttgcgtcttagtcagatacttgtacttcct
ccttaccagcgtaagggttttgggcgcgtccttttagaggtgctgaataatgttgcaata
tcagaaaacgtttacgactttaccattgaagaaccattaagtcagctactgcagttgcga
acctgcatcgatgttaaacgtctgcgggggtttggccccatccaagaagctgtagaatct
gccgtgtctcaatttaaatttggaagactatcaaagaaggtttcattccctccgctttta
cccccatctgaggctatcgaagctgttcggaaaagtttgaaaatcacaaaggaacagttc
ttacactgttgggagatactaatctttttaggtatcgaacctgacaagcacatggaggat
tttattcttgcagtttcaagtagaatgcggaatgatctgataggtgaaagctcagatgcg
gaagggaagcaggtggttgatgttcctactgattatgatcaagagatgtcatttgtgatg
ttcagatcaacaaataatgcaaccggggttgagacagatgaatcacgagcaaatcaagag
gaacagctgaaaaagttagtagatgatagagtgagtgaaatcaaattgattgcacagaag
gtatctgcagattaa

DBGET integrated database retrieval system