KEGG   Cucumis sativus (cucumber): 101223138Help
Entry
101223138         CDS       T02486                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00052  Galactose metabolism
csv00500  Starch and sucrose metabolism
csv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101223138
   00500 Starch and sucrose metabolism
    101223138
Enzymes [BR:csv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     101223138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 101223138
NCBI-ProteinID: XP_004149196
UniProt: A0A0A0LAY1
Position
3
AA seq 576 aa AA seqDB search
MNLFTFLSLLLGFSFFSLFINNGVVFVDALHKIYPELQSIQTDASVIKPLHRTRFHFQPR
RNWINDPNGPMYFKGIYHLFYQYNPKGAVWGNIVWAHSISRDLINWKPLKPAIYPSKPFD
INGCWSGSATVLPGDKPVILYTGIDPQNRQVQNYAIPANLSDPYLTEWIKPDNNPIVDPG
PGVNASAFRDPTTAWLSKSGHWKTVIGSKRKKRGMAYLYRSRDFVKWTKAKHPLHSAANT
GMWECPDFYPVPLRGKLGLDPSVTGNWVKHVFKVSLDLTRYEYYTVGKYFPKKDKYVPDN
TSVDGWSGLRYDYGNFYASKSFYDPLKKRRVLWGWANESDSAQDDVSKGWAGIQLIPRTV
WLDHNQRQLKQWPVKELNTLRGKKVVLSHQKLLKGHTVEVKGITAAQADVEVMFSFSSLD
KADPFDPRWVDAQAACDQLGNSQGGVGPFGLLTLASENLDEFTPVFFRIFKAHHKHVVLM
CSDARSSSLKEEGLYKPAFAGYVDIDLSRKKLSLRSLIDHSVVESFGGGGKTCITSRVYP
TKGVFDDAHLHVFNNGTEAITVEYLRAWSMKSARMN
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcttcacttttctttctcttcttctcggattttccttcttttctctgttcatc
aacaatggcgtcgtcttcgttgacgctctccataaaatttatcctgaattacagtctatt
caaaccgacgcctccgtaattaagcccctccatcgaactcgttttcacttccaacctcgg
cgtaactggatcaacgatccaaatggaccaatgtacttcaagggaatttatcatttgttt
tatcaatacaaccccaaaggcgcagtttggggaaacatcgtttgggctcactcaatttcc
agagacctaatcaattggaagccattgaagcccgccatttacccttcaaagcccttcgac
atcaatggctgctggtccggctctgccaccgtcctccccggcgacaagcccgtcatctta
tacaccggaatcgacccccaaaaccgccaagtccaaaactacgccattccggcaaacctt
tcggatccgtatcttaccgagtggatcaaaccagataacaacccgatcgtcgacccgggt
ccgggagtcaatgccagcgccttccgggacccgacgacagcgtggctgagcaaaagcggc
cactggaagactgtcatcggcagcaagaggaaaaagaggggaatggcgtatttatataga
agtagggattttgtgaagtggacgaaggcgaaacatcctttacattctgccgctaatacg
ggtatgtgggaatgccccgatttctacccggttcctctcaggggcaagcttggattggac
ccttcggtgactgggaattgggttaaacatgtgttcaaggtgagtttggatctcactaga
tatgagtattatacggtggggaagtattttccgaaaaaagataagtatgtaccggataat
acatcggtggatggatggagtgggttgagatatgactatggcaatttctatgcttcgaag
tcgttctatgatccgttgaagaagaggagggttttgtggggttgggctaatgagtctgac
agtgcacaagatgatgtttctaaaggatgggctggaattcagttaattcctaggacggtg
tggttggatcacaaccagaggcagctcaaacaatggccggttaaagagctgaatacgctg
agaggaaagaaagttgtgttgagccatcagaagctgttgaagggacatactgttgaggtt
aaaggaattactgctgcccaggctgatgttgaagttatgttcagcttttcaagtctagat
aaagcggatccatttgatccaagatgggtagatgcccaagccgcatgtgatcaactgggc
aactcccaaggtggagttgggccgtttgggcttctaaccctggcttcagaaaaccttgac
gaattcactcctgtattcttcaggatcttcaaggcccatcacaaacacgtggttcttatg
tgctctgatgccagaagctcttctttgaaggaggaaggattgtacaaaccagcatttgcc
ggctatgtcgacatcgatttatcgaggaaaaagctctcattaagatctttgattgatcat
tcagtggtagaaagctttggaggaggaggaaaaacatgcataacttcaagggtatatcca
acaaagggagtgtttgatgatgctcatttgcatgtgttcaacaatggaacagaagctatc
acagtagaatatctaagggcttggagtatgaaaagtgctaggatgaattaa

DBGET integrated database retrieval system