KEGG   Cucumis sativus (cucumber): 101224153Help
Entry
101224153         CDS       T02486                                 

Definition
hexokinase-3-like
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101224153
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101224153
   00051 Fructose and mannose metabolism
    101224153
   00052 Galactose metabolism
    101224153
   00500 Starch and sucrose metabolism
    101224153
   00520 Amino sugar and nucleotide sugar metabolism
    101224153
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    101224153
Enzymes [BR:csv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101224153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 507 aa AA seqDB search
MGGKLMFGVTVGVAVAACVVATVLVSRRVKSRSKWKRVVGVLEELEATCDTPLRRLRQVV
DAMAVEMHAGLASEGGSKLKMLLTYVDNLPNGSEIGTFYALDLGGTNFRVLRVHLGGQRS
LTLKHDVERQPIPQNLMTGTREGLFDFIASSLKEFVEKTDDPDELAPRRKELGFTFSFPV
KQTSASSGVLIKWTKGFSIEDMVGRDAAESLQQAIDRIGLGLRVSVLINDTVGTLAVGHY
QDPDTVAAVIIGTGSNACYVERTDAIIKCQGLCTTSGSMVINMEWGNFWSSHLPRTTYDI
DLDADSPNPSDQGFEKMISGMYLGDIVRRVILRISQESDVFGPASTRLSMPFKLRTPMMA
AMHEDSSPELTEVARIFEDILEITDIPLKVRKLVVKICDIVTRRAARLAAAGIVGILKKI
GRDGTSGIAGGRSRADVKPRRTVVAIEGGLYTSYTIFREYLHEALVEILGEEIAPHVILK
PTEDGSGIGAALLAASYSSYDTDANLL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgggggggaagttgatgtttggtgttacggtcggcgtagcggtggcggcatgtgtggtg
gccacggtcctagtcagtcggagagttaagagccggagtaagtggaagagagtggtcggg
gttttggaagagcttgaagccacttgtgatactcctctgaggagattgagacaggtggtt
gatgctatggctgtggaaatgcatgctgggttggcttctgaaggtggttccaagcttaaa
atgctactcacatatgttgataatctgcctaatgggagcgagataggaacattttatgct
ctggatcttgggggtactaattttagggttttgagagttcatctcggtggccagaggtct
cttactttgaagcatgatgtggagcggcagccaattccccaaaatttaatgacgggcact
cgcgagggtctatttgattttattgcttcatcactgaaggagtttgtagagaaaacagat
gatcctgatgagttggcccctaggagaaaggaacttggatttacattttcctttcccgtt
aaacaaacatctgcttcatcaggcgtgttgattaaatggactaaaggattttccattgaa
gacatggttggaagagatgctgcagaatctttacaacaagccattgataggattggacta
ggtttgcgggtatcagtactgattaatgacactgtgggaacattagctgttggacattat
caagatcctgacactgttgctgcagttataattgggactgggtccaatgcttgctatgtc
gaacgtacagatgctattatcaaatgccaggggctttgtacgacgtctgggagcatggtt
attaacatggaatggggaaacttttggtcttctcatttaccaagaactacttatgatatt
gatttggatgctgatagccccaatcccagtgatcagggctttgagaagatgatatcgggt
atgtatcttggtgatatcgtgaggagagtgattctgaggatttcacaagaatctgatgtt
tttggccctgcttctactcgattatcaatgcccttcaaattgagaacaccaatgatggct
gcgatgcacgaggacagctccccggaattgacagaagtagcacggatttttgaagacatc
ttggagatcactgatatacccttaaaggttcgaaagcttgtagtgaaaatatgcgatatt
gtgacacgtagagctgctcgcttggcagctgctggtatcgtgggcatcctgaagaagata
gggcgggacgggacaagtggaattgctggtggaagaagtagagccgacgtcaaacctaga
cgaacagttgttgcaattgagggaggtttatatacaagctatacaatcttccgagagtat
ctacatgaagctttggttgaaatactgggagaggagattgccccgcatgttattttgaag
ccaacagaagatggttcgggtattggagcagcactactggcagcttcttattcatcgtac
gatacggacgcaaacttgctatga

DBGET integrated database retrieval system