KEGG   Cucumis sativus (cucumber): 101226361Help
Entry
101226361         CDS       T02486                                 

Definition
histone deacetylase 2-like
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
csv  Cucumis sativus (cucumber)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 351 aa AA seqDB search
MSSSLSPDANDGEAVRRDRILSSKLYFDVPSSKVPVIYSSSYDISFLGIEKLHPFDSKKW
GRVCQFLIAAGVLRKDQIIKPLEAKKNDLLVVHPESYLNSLKNSSNVAKIIEVPPVALFP
HCVVKEKVQRPFRNQVGGSILAGKVAKEKGWAINVGGGFHHCSAERGGGFCVYADISLCI
HYAFVQLNISKAMIIDLDAHQGNGHEMDFAHDRRVYILDMFNPGIYPFDYEARRCIDQKV
EVVSGTTTSEYLKKLDEALEVAATSYDPELIVYNAGTDILDGDPLGLLKISAEGIAKRDE
KVFRFARARNIPIVMLTSGGYMKSSAKVIADSIENLSKQRLIDTESSPHRT
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcttcgctgtctccggatgcgaacgatggggaagctgtccgaagggaccgaatt
ctctccagcaagctgtattttgatgttccttcttcaaaggttccggtgatatattcgtca
tcgtatgacatctcatttcttggaatagagaagttgcatccatttgattcaaagaaatgg
ggtcgtgtatgccaattccttattgccgctggagttttaaggaaagatcaaattatcaag
cctttggaagctaagaagaatgatcttcttgtggtacatccggaatcatacttgaatagt
ctgaagaacagttcaaatgttgctaagattattgaggtccctcctgttgcattgtttcct
cattgtgttgtcaaggagaaagttcaacgtccatttcgtaatcaggttggaggcagcata
ttagctggaaaagtagcaaaagagaaaggatgggccatcaatgtaggaggtggttttcac
cattgctcagcagaacgaggaggaggattttgtgtgtacgcagatatttctctgtgtata
cactatgccttcgttcagcttaacatatcaaaggcaatgattattgatcttgatgcccat
caaggaaatggccatgaaatggattttgcccatgatagacgagtatatattcttgatatg
ttcaatcctggaatatatccttttgattatgaggctagaagatgcattgatcagaaagtt
gaagtagttagtgggaccacaacaagtgaatacttgaagaaattagatgaagcactcgag
gttgctgccacttcatatgatcctgaattaattgtttacaatgctgggactgatattcta
gatggagatccactgggcttgttaaagattagtgctgagggaatagctaagagagatgaa
aaggttttcagatttgctcgtgcaaggaacattcccattgtgatgctgacatcaggcggt
tacatgaaatctagcgctaaagtcattgctgattcaattgaaaatctctcgaagcaaagg
ttaattgatacagaaagctctccacacagaacgtag

DBGET integrated database retrieval system