KEGG   Cucumis sativus (cucumber): 101226361Help
Entry
101226361         CDS       T02486                                 

Definition
histone deacetylase 2-like
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
csv  Cucumis sativus (cucumber)
Brite
Enzymes [BR:csv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101226361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 351 aa AA seqDB search
MSSSLSPDANDGEAVRRDRILSSKLYFDVPSSKVPVIYSSSYDISFLGIEKLHPFDSKKW
GRVCQFLIAAGVLRKDQIIKPLEAKKNDLLVVHPESYLNSLKNSSNVAKIIEVPPVALFP
HCVVKEKVQRPFRNQVGGSILAGKVAKEKGWAINVGGGFHHCSAERGGGFCVYADISLCI
HYAFVQLNISKAMIIDLDAHQGNGHEMDFAHDRRVYILDMFNPGIYPFDYEARRCIDQKV
EVVSGTTTSEYLKKLDEALEVAATSYDPELIVYNAGTDILDGDPLGLLKISAEGIAKRDE
KVFRFARARNIPIVMLTSGGYMKSSAKVIADSIENLSKQRLIDTESSPHRT
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcttcgctgtctccggatgcgaacgatggggaagctgtccgaagggaccgaatt
ctctccagcaagctgtattttgatgttccttcttcaaaggttccggtgatatattcgtca
tcgtatgacatctcatttcttggaatagagaagttgcatccatttgattcaaagaaatgg
ggtcgtgtatgccaattccttattgccgctggagttttaaggaaagatcaaattatcaag
cctttggaagctaagaagaatgatcttcttgtggtacatccggaatcatacttgaatagt
ctgaagaacagttcaaatgttgctaagattattgaggtccctcctgttgcattgtttcct
cattgtgttgtcaaggagaaagttcaacgtccatttcgtaatcaggttggaggcagcata
ttagctggaaaagtagcaaaagagaaaggatgggccatcaatgtaggaggtggttttcac
cattgctcagcagaacgaggaggaggattttgtgtgtacgcagatatttctctgtgtata
cactatgccttcgttcagcttaacatatcaaaggcaatgattattgatcttgatgcccat
caaggaaatggccatgaaatggattttgcccatgatagacgagtatatattcttgatatg
ttcaatcctggaatatatccttttgattatgaggctagaagatgcattgatcagaaagtt
gaagtagttagtgggaccacaacaagtgaatacttgaagaaattagatgaagcactcgag
gttgctgccacttcatatgatcctgaattaattgtttacaatgctgggactgatattcta
gatggagatccactgggcttgttaaagattagtgctgagggaatagctaagagagatgaa
aaggttttcagatttgctcgtgcaaggaacattcccattgtgatgctgacatcaggcggt
tacatgaaatctagcgctaaagtcattgctgattcaattgaaaatctctcgaagcaaagg
ttaattgatacagaaagctctccacacagaacgtag

DBGET integrated database retrieval system