KEGG   Cucumis sativus (cucumber): 101226405Help
Entry
101226405         CDS       T02486                                 

Definition
uncharacterized LOC101226405
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101226405
Enzymes [BR:csv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     101226405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 174 aa AA seqDB search
MGNEARWSWWRVFIVAGVAVTGFLFSSSSASQPEQLMETQPVVSRIAFGSCANQDAPQPI
WNSIINFDPHVFIWLGDNIYGDIRRPFKLFGRERTVGPWKNVPRFIPSSKQEMMLKYNKG
KTIPGYSRLRQRTKVIGVWDDHDYGLNDAGKEFTEKVTNQKLLLDFLDEPLDSP
NT seq 524 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgaggcaagatggagctggtggcgggttttcattgtggcgggagtggcggta
actggatttcttttttctagcagcagtgcttcacaaccggagcaattgatggagactcag
cctgtggtatccaggatcgcgtttggatcatgcgccaaccaggacgctcctcagccaatc
tggaactccataatcaactttgacccacatgttttcatttggcttggtgataacatctat
ggagacattaggcgtccattcaaattatttggtcgagaaaggacggtaggaccgtggaaa
aatgttccacgtttcattccttcatctaagcaggaaatgatgctcaaatacaataagggc
aagacaattccaggctattctcggcttagacagaggaccaaggtaatcggtgtctgggat
gaccatgattatggattaaatgatgctggaaaggaatttaccgagaaggtcactaatcag
aagcttctccttgattttttagacgaacctcttgatagtccaag

DBGET integrated database retrieval system