KEGG   Cucumis sativus (cucumber): 101229222Help
Entry
101229222         CDS       T02486                                 

Definition
histone acetyltransferase GCN5-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
csv  Cucumis sativus (cucumber)
Brite
Enzymes [BR:csv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101229222
Transcription machinery [BR:csv03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101229222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 561 aa AA seqDB search
MDTHSAHLTATNRSRSSQSPSPSHSASASATSSIHKRKLASEDHVPPFPPSFSAETRDGA
LTSNDDLESISARGGGADSDSDDDSDDAVVEDDEDDFDNDSSMRNFTTARLENSGPGGSA
SASASASAARTTKIKPNATVKIENADINKDGGTVGGTNAAGSAAGTTGNSVSGIVVKEDT
SKIFADSVQTSGAYISREENLKREEEAALLKFVCLSNDGVDEHMVWLIGLKNIFARQLPN
MPKEYIVRLVMDRNHKSVMVIRRNQVVGGITYRPYVSQKFGEIAFCAITADEQVKGYGTR
LMNHLKQHARDVDGLTHFLTYADNNAVGYFTKQGFTKEIHLEKDRWQGYIKDYDGGILME
CKIDPKLPYTDLSSMIRRQRQAIDEKIRELSNCHIVYPGLDLQKKEAGVPKRPIKVEEIP
GLKEAGWTPDQWGFSRYRALNSADGISNQKHLAAFMRSLLKSMYDHVDAWPFKEPVDSRD
VPDYYEIIKDPVDLKTMSKRVESEQYYITFEMFVADVRRMFVNARTYNAPETIYYKCATR
LESHFQSRLQSGLQSANKIQP
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggatacccactcggctcacctcactgctaccaatcgttcccgcagttctcaatcccct
tccccatcccactccgcttccgcctctgccacctcctccatccacaagcgcaaattggcc
tccgaggatcacgtacctcctttccctccatctttttccgccgaaacacgcgacggggcg
ctaacatccaatgatgaccttgaaagcatctcagctcgcggcggcggcgctgactccgac
tccgacgacgattctgacgatgccgtggtcgaggacgacgaggatgacttcgataatgat
tcttccatgcgtaacttcaccactgctcgacttgagaacagcggtcctggcggttctgct
tcagcatctgcctctgcttcggctgcgcgtacaaccaagatcaagccaaatgcaacggtg
aagatcgaaaatgcggatatcaacaaggacggaggcacggttggtggaaccaatgcagcg
ggttctgcagctgggacaacgggaaattccgtgtccggaattgtcgtgaaggaagatact
tcgaaaatttttgccgacagtgtacagaccagcggtgcctatatttccagagaagagaac
ttaaagagagaggaggaggctgcgttactcaaatttgtctgcctttcaaacgacggtgtt
gatgagcatatggtttggttaattggattgaagaatattttcgcccgacaactacctaac
atgcccaaggaatacattgttcgtcttgttatggacagaaaccataagtcagtgatggtt
ataagacgaaatcaagttgttggtggcatcacatatcgcccatatgtcagtcaaaaattt
ggcgagatagccttttgtgctattacagctgatgagcaagtaaaaggatatggtaccaga
ttgatgaatcacttaaaacagcacgcacgtgatgttgatggccttactcattttctcaca
tatgctgataataatgctgttggctactttactaagcagggattcacaaaagaaatacac
ctggagaaggacaggtggcaggggtacataaaagactacgatggaggaattcttatggaa
tgcaaaatcgatcctaaacttccatacaccgatctgtcttctatgattcgtcgtcagagg
caggcaattgacgagaaaataagagagctttcaaattgccacattgtttatcctggcctt
gatcttcaaaagaaggaggcaggagttcccaaaagacccatcaaagttgaggagattccg
ggtttgaaggaagccggatggacacctgatcagtggggcttctcacgttacagagcctta
aactctgccgacgggatctcaaatcagaaacatttggctgcattcatgcgctcacttctc
aagtcaatgtatgaccatgttgatgcatggccattcaaagaaccagttgattctcgtgac
gtgcctgactactatgaaatcattaaggatccagtggatttaaagacgatgtccaagagg
gtggagtcagaacaatattacattacttttgagatgttcgtcgcagatgtgagaagaatg
tttgttaatgcacgcacgtataatgctcccgagactatttattataagtgtgcaacgagg
ctggaatcacattttcaaagtaggcttcaatcaggtttacaatctgctaacaaaattcag
ccatga

DBGET integrated database retrieval system