KEGG   Chlamydia trachomatis Sweden2: SW2_0881Help
Entry
SW2_0881          CDS       T01966                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
csw  Chlamydia trachomatis Sweden2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SW2_0881 (malQ)
Enzymes [BR:csw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SW2_0881 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(100528..102111)
Genome map
AA seq 527 aa AA seqDB search
MPSLSQSRRIIQQSSIRKIWNQIDTSPKHGVCVPLFSLYTQESCGIGEFLDLIPMIDWCI
SCGFQILQILPINDTGSCSSPYNSISSIALNPLHLSISALPYKEEVPAAETRIREMQQLS
QLPQVHYEKVRSMKRDFFQEYYRVCKQKKLTDHPDFYAFCEQEKYWLHPYALFRSIREYL
DNLPINHWPTTYTDLSQITEHERTFAEDIQFHSYLQYLCFQQMTQVREHANCKSCLIKGD
IPILISKDSCDVWFYRHYFSSSESVGAPPDLYNAEGQNWHLPIYNMKTLQQDNYLWWKER
LRYAENFYSLYRLDHVVGLFRFWVWDESGCGRFEPHNPKDYLAQGQDILSHLLTSSSMLP
IGEDLGTIPSDVKRMLESFAVCGTRIPRWERNWEGNGAYTPFDQYDPLSVTSLSTHDSST
LASWWKESPQESKLFAQFLGLPYSSTLSLHNHTEILKLSHKTSSIFRINLINDYLALFPD
LISKTPRYERINLPGTISKNNWVYRVKPSIEDLSSHSKLNSLLEALF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcattatcccaatcccgacgtatcatccagcaatcttccattcgaaagatttgg
aatcagatagatacttctcctaagcatggcgtatgtgtaccgttattttctctctatact
caagaaagttgtgggataggtgaatttcttgacctgattcctatgatcgattggtgtatc
tcgtgtggttttcaaatccttcaaattcttccgattaacgatacagggtcctgttcgagt
ccttacaatagcatttcttcgatagcactcaatcctcttcacctttctatctctgcgctc
ccctataaagaagaagtgccagctgcggaaacacgcatacgagaaatgcagcaactctct
caacttcctcaagtacattatgaaaaagttcgctctatgaagagagatttttttcaagag
tactaccgcgtgtgtaaacagaaaaaactcactgatcatcctgatttttatgccttctgt
gaacaggaaaaatattggttacatccctacgctctctttcgctctatccgagaatatttg
gataaccttcctattaatcattggccaaccacctacacagatctctcccagattaccgag
catgaacgtacttttgcggaagatatacaatttcactcttatctacagtatttgtgcttc
caacagatgacacaagtgcgggagcatgccaattgcaaaagctgtctcatcaaaggggat
atccctattctaatcagtaaagatagctgcgatgtctggttttataggcattacttttcc
tcttcagaatctgtaggtgctcctcctgacctgtataatgcggaaggtcagaactggcat
ctccccatttataatatgaaaactttgcaacaagataactacctctggtggaaggagcgc
ttacgttatgcggagaatttttactctttataccgtcttgatcatgtcgtcggtctcttt
cgattttgggtatgggatgagtctggatgcggacgctttgaacctcataatccgaaagac
tatctagctcaagggcaagatatcttatctcacctcttgaccagttcatctatgctacct
ataggagaagatctgggaacgatcccttccgatgtgaaacgtatgctcgagtcttttgcc
gtatgcggcactagaattcctcgttgggaacgaaactgggaagggaatggagcctatacc
cctttcgatcaatacgaccctctatccgtcacaagcctctctactcatgattcctctaca
ttagcctcatggtggaaagaatctcctcaggaatccaaactatttgctcagtttttagga
ctcccctattcttccaccctatctcttcacaatcataccgaaatcctgaaactctctcac
aaaacctcttctatttttcgcatcaatcttattaatgactatctggctctgttcccggat
ttgatatcaaaaactcctcgctacgaaagaatcaatctgccaggaactatttcaaaaaat
aattgggtgtatcgagttaagccttctattgaagatttatcctctcattctaagctaaat
tctttacttgaggctctattttag

DBGET integrated database retrieval system