KEGG   Chlamydia trachomatis Sweden2: SW2_1711Help
Entry
SW2_1711          CDS       T01966                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
csw  Chlamydia trachomatis Sweden2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SW2_1711 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SW2_1711 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SW2_1711 (trpB)
Enzymes [BR:csw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SW2_1711 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
193461..194639
Genome map
AA seq 392 aa AA seqDB search
MFKHKHPFGGAFLPEELLAPIQNLKAEWEILKTQQSFLSELDCILKNYAGRQTPLTEVKN
FARAIDGPRVFLKREDLLHTGAHKLNNALGQCLLAKYLGKTRVVAETGAGQHGVATATAC
AYLGLDCVVYMGAKDVERQKPNVEKMRFLGAEVVSVTKGSCGLKDAVNQALQDWATTHSF
THYCLGSALGPLPYPDIVRFFQSVISAEVKEQIHAVAGRDPDILIACIGGGSNAIGFFHH
FIPNPKVQLIGVEGGGLGISSGKHAARFATGRPGVFHGFYSYLLQDDDGQVLQTHSISAG
LDYPSVGPDHAEMHESGRAFYTLATDEEALRAFFLLTRNEGIIPALESSHALAHLVSIAP
SLPKEQIVIVNLSGRGDKDLPQIIRRNRGIYE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacataaacatccttttgggggagcgttccttcccgaagaactattagcccct
atacagaatctaaaagcggaatgggagattctcaaaactcagcaaagttttttatctgaa
ctagattgtattttgaaaaactatgcggggagacaaactcctctgactgaagttaagaat
tttgctcgagctattgatggccctagagtatttcttaaacgcgaagatcttttgcataca
ggagcacataaactgaataatgctcttggtcagtgtttgcttgctaaatatcttgggaaa
acacgtgttgtagctgaaacaggtgcgggacaacatggagtagcaacagcaacagcgtgt
gcttatctaggattagattgtgtagtatacatgggagcaaaagatgtggaacgacagaaa
ccaaatgtagagaaaatgcgctttttaggtgctgaagtcgtttctgtaacaaaaggatct
tgtggactcaaagatgcagttaatcaagctctacaagattgggcaacaacacactcattt
actcactattgcttaggatcggccttaggacctttaccttatcccgatatcgttcgattt
tttcagtctgttataagcgctgaagtgaaagagcaaatccatgcagttgcaggaagagat
cctgatattctgattgcatgtatcggaggtggctccaacgctattggatttttccatcat
tttatcccgaatccaaaagtccaattaattggagtggaagggggaggactgggcatttct
tcaggaaaacatgcagcacgttttgcaacagggcgacctggagtattccacggattttat
tcgtatcttcttcaagatgacgatggacaagtattacaaactcactccatttccgctgga
ttagattatccttcagttgggccagatcatgccgaaatgcatgagtcaggacgagccttt
tatacattagccaccgatgaagaggcgttacgagcttttttcctgcttactagaaacgag
gggattattcctgcattggagtcttcacatgctctcgcacatttagtttcgattgctcct
tctctaccaaaggaacaaatcgtcatcgttaacttatctggaagaggtgataaggatctt
ccacaaatcatccgcagaaacagaggaatttatgagtaa

DBGET integrated database retrieval system