KEGG   Chlamydia trachomatis Sweden2: SW2_1721Help
Entry
SW2_1721          CDS       T01966                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
csw  Chlamydia trachomatis Sweden2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SW2_1721 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SW2_1721 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SW2_1721 (trpA)
Enzymes [BR:csw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SW2_1721 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
194632..195393
Genome map
AA seq 253 aa AA seqDB search
MSKLTQVFKQTKLCIGYLTAGDGGTSYTIEAAKALIQGGVDILELGFPFSDPVADNPEIQ
VSHDRALAENLTSETLLEIVEGIRAFNQEVPLILYSYYNPLLQRDLDYLRRLKDAGINGV
CVIDLPAPLSHGEKSPFFEDLLAVGLDPILLISAGTTPERMSLIQEYARGFLYYIPCQAT
RDSEVGIKEEFRKVREHFDLPIVDRRDICDKKEAAHVLNYSDGFIVKTAFVHQTTMDSSV
ETLTALAQTVIPG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattaacccaagtttttaaacaaactaagctatgtattggctatctaaccgct
ggtgatggcggtactagttatactattgaggcggcaaaagctctgattcaaggaggtgtc
gatattctggaactaggatttcctttttctgatcctgttgcagataatccagaaattcaa
gtatctcatgatcgggctttagcagaaaatctgacgtcagaaactttgttagagatcgta
gaaggtatccgagcttttaatcaagaagtcccattgatcttatatagctactacaatccg
cttctacaaagggacttagattatctacgcagactaaaagacgcgggaataaatggtgtg
tgcgttatagatcttccagcacctttatcacacggagaaaaatctccattttttgaagat
cttttagctgtaggattggatcctattttgcttatttctgcagggacaacgccggagcgg
atgtctttaatacaagaatacgcaagaggctttctgtattatatcccatgtcaagctacg
agagattctgaagtaggtatcaaagaagaatttcgaaaagtcagagaacattttgatctt
ccaattgtagatagaagagatatttgtgataaaaaagaagctgcacatgtgctgaattat
tcagatggtttcattgtgaaaacagcgtttgttcatcagacaacaatggattcttcggta
gagactctgactgcacttgcacaaacagttattcctggataa

DBGET integrated database retrieval system