KEGG   Chlamydia trachomatis Sweden2: SW2_1721Help
Entry
SW2_1721          CDS       T01966                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
csw  Chlamydia trachomatis Sweden2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:csw01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:csw00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:csw00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
194632..195393
Genome map
AA seq 253 aa AA seqDB search
MSKLTQVFKQTKLCIGYLTAGDGGTSYTIEAAKALIQGGVDILELGFPFSDPVADNPEIQ
VSHDRALAENLTSETLLEIVEGIRAFNQEVPLILYSYYNPLLQRDLDYLRRLKDAGINGV
CVIDLPAPLSHGEKSPFFEDLLAVGLDPILLISAGTTPERMSLIQEYARGFLYYIPCQAT
RDSEVGIKEEFRKVREHFDLPIVDRRDICDKKEAAHVLNYSDGFIVKTAFVHQTTMDSSV
ETLTALAQTVIPG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattaacccaagtttttaaacaaactaagctatgtattggctatctaaccgct
ggtgatggcggtactagttatactattgaggcggcaaaagctctgattcaaggaggtgtc
gatattctggaactaggatttcctttttctgatcctgttgcagataatccagaaattcaa
gtatctcatgatcgggctttagcagaaaatctgacgtcagaaactttgttagagatcgta
gaaggtatccgagcttttaatcaagaagtcccattgatcttatatagctactacaatccg
cttctacaaagggacttagattatctacgcagactaaaagacgcgggaataaatggtgtg
tgcgttatagatcttccagcacctttatcacacggagaaaaatctccattttttgaagat
cttttagctgtaggattggatcctattttgcttatttctgcagggacaacgccggagcgg
atgtctttaatacaagaatacgcaagaggctttctgtattatatcccatgtcaagctacg
agagattctgaagtaggtatcaaagaagaatttcgaaaagtcagagaacattttgatctt
ccaattgtagatagaagagatatttgtgataaaaaagaagctgcacatgtgctgaattat
tcagatggtttcattgtgaaaacagcgtttgttcatcagacaacaatggattcttcggta
gagactctgactgcacttgcacaaacagttattcctggataa

DBGET integrated database retrieval system