KEGG   Chlamydia trachomatis Sweden2: SW2_6441Help
Entry
SW2_6441          CDS       T01966                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
csw  Chlamydia trachomatis Sweden2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:csw00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
721136..722152
Genome map
AA seq 338 aa AA seqDB search
MTRLPLLKRPRRNRKSAAVRSIIQETQLCSSDLIWPIFLKDGSGIREEIESMPGVYRWSL
DMVSKELERLCTIGLKAVILFPVIDANKKEQFGSYASHPYNIVCKGIQAIKKSFPELCVI
SDIALDPFTTSGHDGIFHNNYVINDESVRVYGGIAVMHAEMGADIVAPSDMMDGRVKHIR
EQMDQMGFVNTGILSYSAKYASALYGPFRDALSSHLQSGDKRTYQMDPANVQEALLECQL
DEEEGADMVMIKPAGFYLDVIVKARENTHLPVVAYQVSGEFSMIMAACLHGWLNKESVIK
ESLLAIKRAGATAIISYATPWVLEWLAKDALPFERSVL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggcttccattactaaaacgacctcgcagaaaccgaaaaagtgcagccgttcga
tctataattcaagaaacccaactctgttctagtgacttgatctggcccatctttcttaaa
gatggctctggaattcgagaagaaatagagagtatgcctggagtatacagatggagttta
gacatggtctctaaagagttagagagactttgtacgataggattgaaagcagttatcctc
tttcctgtaattgatgctaataaaaaagaacaatttggatcctatgcgtcccatccttac
aacattgtttgtaaagggattcaagcgataaaaaaatcttttccagaattatgtgtcatc
agtgacatagctttagatccttttacaaccagtggtcacgatgggatttttcataataac
tacgttatcaatgatgaaagtgtccgtgtatatgggggtatcgctgtcatgcatgcggaa
atgggagcagatattgttgctcctagcgatatgatggatgggagagtgaagcatattcga
gagcagatggatcagatggggtttgtcaacacgggtattctctcgtacagtgcaaaatat
gcatctgcattgtatggcccatttcgggatgctctttcttcacatcttcagtctggagat
aagcgtacatatcaaatggatcctgccaatgttcaagaagcgttgctagagtgtcagtta
gatgaagaagaaggcgctgatatggtgatgataaaacccgcaggtttttatctagatgta
atcgttaaagcgagagaaaacacccatcttccggtggtagcctatcaagtcagcggggaa
ttttctatgattatggctgcttgccttcatgggtggttaaacaaagaaagtgtaataaaa
gaatctttattagcgattaagagagctggtgcaacagctataattagttacgcaacacca
tgggttttagaatggctagctaaagatgctcttccctttgagagaagtgttctttga

DBGET integrated database retrieval system