KEGG   Chlamydia trachomatis Sweden2: SW2_6631Help
Entry
SW2_6631          CDS       T01966                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
csw  Chlamydia trachomatis Sweden2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:csw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SW2_6631 (recD)
Enzymes [BR:csw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SW2_6631 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
749383..750873
Genome map
AA seq 496 aa AA seqDB search
MNVNQHVQDIVPSLLTQHILLPFDIAFAQKHLSQEEFSQEAEAFLATASALLRCGYPYFS
ICDETIHPTLPGISNKQLFQWFQLLSSRIKEELFEVVNHKIYLRSLFLLREKVFHKLHRL
AGAVPRTPLIFEEIALLSEEQNQVLKTVLNSCFSLVCGGPGTGKTFLAVQMIRLILAQIP
SAQIVVASPTGKASAHLHSVLTSQGIVGDSVEVVTIHKFLKDMRRGRSPVDLLLVDEGSM
VTMNLLHGLIKTIRGESRGETIYADRMVIFGDANQLPPIGIGVGNPFHEVVSEFSKQACF
LSTSHRAKHKELQELASAVLRKELIPFQPLPSRQEAIRRLSFAFTQAAKEGVSLCALTPM
RQGLWGFLQLNRLLFNEMQEKHPRAPIPIIVTERYETWGLTNGDTGVLDPVTQQLRFMNG
EILHQADFPYYSYNYVMSVHKSQGSEYDRVIVILPKGSEVFDSAILYTAITRTKQHVEIW
ADREALEAIILKRGRY
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtaaatcagcacgttcaagatattgtaccatctttgttaacacaacatattctt
ctcccttttgatatagcttttgctcaaaagcatttatcccaggaagagtttagtcaggaa
gcagaagctttcttagctacagcatccgcattattgcgttgtggttatccttatttttct
atttgtgatgagacgattcatcccacgctcccagggatttcaaataaacaactcttccaa
tggttccagctgttgtcatcccgcataaaagaagaactgtttgaagttgttaatcataag
atttatctacgctcattatttcttttacgggagaaggtgtttcataaattgcacagattg
gcgggagccgttccacgtacacctttaatttttgaagagattgctctgctctcagaagag
cagaaccaggtactgaaaactgtattaaattcttgcttctctctcgtttgtggaggacca
ggaacaggcaaaacatttttagctgttcagatgattcggttgatacttgcgcaaattcct
tcagcgcagatcgtggtagcttctccaacggggaaagcttccgctcatctgcatagcgta
ttaacgtctcagggaatcgttggagattctgtagaagtcgttacgattcataaattttta
aaagatatgcgtagaggacgctcccctgtagatctactattggttgatgaaggctcgatg
gtgaccatgaatctgttacatggactgattaaaaccatacgaggagaatcccgaggggaa
acgatctacgcagatagaatggtgatttttggggatgcgaatcagcttcctccgataggt
atcggagtagggaacccttttcatgaagttgtgtctgagttttccaaacaagcctgcttt
ttatctactagccaccgagctaaacataaggaattacaggaattagcgagcgctgttctg
cgcaaggagctgattccttttcaacctttgccttcccgacaagaagctattcggcgattg
tcttttgcttttacacaagcagcaaaagaaggggtgtcgttatgtgctttgactccgatg
cgccaaggactttggggttttttgcagttgaatcggttgttgtttaatgagatgcaggag
aaacatccacgggcacctattcctatcatcgtgacagaaagatatgaaacgtggggatta
acgaatggagatacaggagttttagatcctgtaacgcaacaattgcgtttcatgaatgga
gagattctgcatcaagcagattttccctattattcttacaactatgtcatgtctgtgcac
aaaagtcagggtagtgaatatgatcgtgtgattgtcattcttcctaaaggcagtgaagtc
tttgattcggcaattctctatactgcaattacaagaaccaaacaacacgttgagatttgg
gctgatcgagaagctttagaggcgatcattttgaaaagagggcgttattaa

DBGET integrated database retrieval system