KEGG   Chlamydia trachomatis Sweden2: SW2_7341Help
Entry
SW2_7341          CDS       T01966                                 

Gene name
pgmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
csw  Chlamydia trachomatis Sweden2
Pathway
csw00010  Glycolysis / Gluconeogenesis
csw00260  Glycine, serine and threonine metabolism
csw00680  Methane metabolism
csw01100  Metabolic pathways
csw01110  Biosynthesis of secondary metabolites
csw01120  Microbial metabolism in diverse environments
csw01130  Biosynthesis of antibiotics
csw01200  Carbon metabolism
csw01230  Biosynthesis of amino acids
Module
csw_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:csw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SW2_7341 (pgmA)
  Energy metabolism
   00680 Methane metabolism
    SW2_7341 (pgmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SW2_7341 (pgmA)
Enzymes [BR:csw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SW2_7341 (pgmA)
Membrane trafficking [BR:csw04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SW2_7341 (pgmA)
Exosome [BR:csw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SW2_7341 (pgmA)
  Exosomal proteins of melanoma cells
   SW2_7341 (pgmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBJ15247
Position
complement(834788..835468)
Genome map
AA seq 226 aa AA seqDB search
MTLLILLRHGQSAWNQKNLFTGWVDIPLSQQGIQEAIAAGESIKHLPIDCIFTSTLVRSL
MTALLAMTNHSSQKVPYIVHEERPDMSRIHSQKEMEQMIPLFQSSALNERMYGELQGKNK
QEVAAQFGEEQVKLWRRSYRIAPPQGESLFDTGQRTLPYFQERIFPLLQQGKNIFISAHG
NSLRSLIMDLEKLSEEQVLSLELPTGQPIVYEWTGQKFTKHAPSLG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttcttatcttgctacgccatggccaatccgcatggaatcaaaaaaatctgttt
acaggctgggtagacatccctcttagccaacaaggaattcaagaggctattgccgctgga
gaatctattaaacatcttcctattgattgcatcttcacttccaccttggttagaagtttg
atgacagccctgttagcaatgactaaccacagctctcaaaaagttccttatatcgttcat
gaagagcgccccgacatgagccggattcatagtcaaaaagaaatggagcagatgatccct
ctttttcaatctagcgctctcaatgaacgcatgtacggagaacttcaaggaaaaaataaa
caagaagtcgctgctcaattcggagaagaacaggtaaaactgtggcgccgaagctaccgc
attgcccctcctcagggcgaaagtcttttcgatacagggcaacgaaccctcccctatttt
caagagagaattttccctctccttcagcaagggaaaaatatttttatctctgctcacggg
aattctttgcgctccttaattatggacctagaaaaattatctgaagaacaagtactctct
ttggagttgccaacaggacagcctattgtatacgaatggacgggacaaaaattcacgaaa
cacgctccttctcttggttaa

DBGET integrated database retrieval system