KEGG   Chlamydia trachomatis Sweden2: SW2_8361Help
Entry
SW2_8361          CDS       T01966                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase beta chain
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
csw  Chlamydia trachomatis Sweden2
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SW2_8361 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SW2_8361 (sucC)
   00640 Propanoate metabolism
    SW2_8361 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SW2_8361 (sucC)
Enzymes [BR:csw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SW2_8361 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
965769..966929
Genome map
AA seq 386 aa AA seqDB search
MHLHEYQAKDLLTAYQLPIPPYHVATSVPEVETAIQAEQWKAGVVKAQVHAGGRGKNGGV
VIAHSPEDLLAAADKLLHMQFSSNQTAGLSLPINKVLISPLVEIASEYYLAIVIDRKHRC
PVIMLSKAGGVDIEEVAEKQPDQLLKMTLPSSGKIYGYQLRRIAKFMEWDQPIADQGNRI
IRQLLQCFYEKDASLLEINPLVLTKDGSLVILDAKMTIDDNALYRHPQLADCYDPSQENI
RDVLAKQLGLSYIALDGTIGCLVNGAGLAMSTLDILKLYGGSAANFLDVGGSASEKQIQE
AISLVLSDKSVRVLFIHIFGGIMDCAVVASGLVSAMQGQKETIPTVIRLEGTNVDKGKDM
IINAGIPCEFVTSMSEGAELAVQLSR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttcatgagtatcaagctaaggaccttttaactgcttatcaacttcctattccc
ccctatcacgtagcgacctccgtacctgaagtagaaacagcgattcaagccgaacaatgg
aaagctggtgttgtgaaagcacaggttcatgctggaggaagaggaaaaaatggaggggtg
gttattgcgcactctccggaagacttattagcagcagctgataagctactgcatatgcaa
ttttctagtaatcagacagcagggttgtctcttcctattaataaagtattgatttcccct
ttagtagagattgcttcggagtattatcttgcgatcgtcatcgatagaaaacatcgttgt
cctgtcattatgctatctaaagcaggaggtgtggatatcgaggaagtcgcagaaaagcag
ccggatcagctgcttaaaatgacactaccttcttctggaaaaatttatgggtatcagtta
cgccgtattgctaagttcatggagtgggatcaacctattgccgatcaagggaatcgtatc
attcgccagttattacaatgtttttatgaaaaggatgcttctttattagagattaatcca
ttggtacttactaaagacgggtctcttgtcattctagatgccaaaatgacgattgatgac
aatgctctttatcgacatcctcagctagcagactgctatgatccttctcaggaaaatatt
cgtgacgtactagctaagcagttaggcctttcatacattgctctagatggaacaatcgga
tgtttagtcaatggtgcaggattagcgatgagcaccttagatattctgaagttatatggc
ggttctgctgccaatttcttagatgtaggaggaagtgcttctgaaaagcaaattcaagaa
gccatctctttagtcttatctgataaaagtgtgcgcgtgctctttatccatatttttggg
gggattatggattgtgcagtcgtcgcttctggacttgtttctgctatgcaaggacagaaa
gaaacgatccctactgtaattcggttagaagggacgaatgtagataaaggaaaggacatg
attattaacgcaggaattccttgtgagttcgttacatccatgagcgagggggctgaactc
gctgtgcaattaagtcgttag

DBGET integrated database retrieval system