KEGG   Cenarchaeum symbiosum A: CENSYa_0110Help
Entry
CENSYa_0110       CDS       T01380                                 

Definition
succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
csy  Cenarchaeum symbiosum A
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:csy01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:csy00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:csy00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:csy00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(85041..86138)
Genome map
AA seq 365 aa AA seqDB search
MEYQAKELFAEYGIKVPQGRASKGIEQARKDAKDIGYPFVIKIQVPVGGRGKAGGIQKCT
NEDELVLRYPQVYDLTIKGERARAILLEKMADISKELYLSLFLNRSKRCYTVIASAEGGV
EIESVKSQIIKEVGLGKVSPEVAAQVASEMGLEGAAAKDLSDILQKLSLLTTEKEAELAE
INPLAILSDGTLLALDGKVMTDDNAAFRHQELEKYRESSELEERAQKSGFSLVELDGNIA
VVGNGAGLVMSTLDMLSDSGGRPACFLDVGGGATTESVYEALTLINKMDRVKGILVNLYG
GIVKTTTIASAFLKAYDDGIVDLPVYARLRGAESDKAREMLKSSSTNLYDTVEDAISAAV
MGIEK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
ttggagtatcaggcaaaggagctctttgcagaatacgggataaaggtgccgcagggcagg
gcatcaaagggaatagaacaggcaagaaaagatgccaaggacataggatacccgtttgtc
ataaagatacaggtgccagtcgggggccgcggcaaagcaggcgggatacaaaaatgcaca
aacgaagacgagcttgtactgcggtatccgcaggtgtacgacctgacgataaagggcgag
agggcaagggcaattttactagagaagatggccgacatatcaaaggagctctacctgtcg
ctgttcctaaacaggagcaaaagatgctatactgtgatagcatccgcagaagggggagtg
gagatagaatcagtaaaaagccagatcataaaggaggtcggcctggggaaggtaagcccg
gaggtcgcagcacaagtggcatctgagatgggcctcgagggtgctgccgccaaagatcta
tccgacatactgcaaaagctctcactactcactacagaaaaagaggcggaattggcagag
ataaaccccctggccatactatcagatgggacactcttggctttagacggcaaggtaatg
accgatgataatgccgcattcaggcaccaagagctggaaaagtacagggaatcctccgag
ctcgaagagagggcccagaagagcggattctcacttgtcgagcttgacgggaacattgct
gtagtggggaatggcgcggggctagtcatgtcgacacttgatatgctctctgacagcggg
ggcaggcccgcgtgctttttggatgtgggaggcggtgccactacagaatcagtctatgaa
gcccttaccctgataaacaaaatggacagggtaaagggaattctggttaacctgtacggg
ggcatagtaaagactacaacgatagcgtctgcatttctaaaggcgtacgatgatggaata
gtggacctgccagtatatgccagattaaggggcgcagaatccgacaaagccagagagatg
ctaaagagctcgagcaccaacttgtacgatacggtagaggacgctataagcgcagcagta
atggggatcgaaaaatga

DBGET integrated database retrieval system