KEGG   Cenarchaeum symbiosum: CENSYa_0292Help
Entry
CENSYa_0292       CDS       T01380                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
csy  Cenarchaeum symbiosum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CENSYa_0292
   00030 Pentose phosphate pathway
    CENSYa_0292
   00051 Fructose and mannose metabolism
    CENSYa_0292
   00052 Galactose metabolism
    CENSYa_0292
   00500 Starch and sucrose metabolism
    CENSYa_0292
   00520 Amino sugar and nucleotide sugar metabolism
    CENSYa_0292
  Nucleotide metabolism
   00230 Purine metabolism
    CENSYa_0292
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CENSYa_0292
Enzymes [BR:csy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CENSYa_0292
    5.4.2.8  phosphomannomutase
     CENSYa_0292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
252466..253737
Genome map
AA seq 423 aa AA seqDB search
MAMSISAHLGGGPVLVGHDGRHSGPAVAKAVCSALNYAGADCSLAGLVPTPCLEYSTRKL
GYRGGIMVTASHNPPEYNGMKVVASDGVEIPREDEEKIEGIYRDKAFRPGEKYGVMRAED
GAIPAYLDGIKSQVDASAVRARGPSVVIDAGNGAQAVAAPQLCRDLGCTVEVINSGIDGD
FPGRGPEPTPANLGGLSEAVLRTGADLGVAFDGDGDRSLFCDDKGEVLTGDRSALLLAGF
VLGSSPGSAVVTCLNSGGAIEGVAAGHGSPVIRTKVGSVAVSRRMVSEDALVGFEENGGF
MYGRHGQVRDGAMSLALMLGLVSSSDMPLSSMAAALPPSFTSKEKIPCSAADAERVLDVL
RSEHPEADTTDGIRIAQGGSWTMVRPSGTEPLIRVYAESHSEAALSELLSGQVRRIREIL
DGG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggccatgtccatatcggcacacctcgggggcgggccggtccttgtgggccacgacggc
aggcactcggggcccgccgtggcaaaggccgtatgctcggcgctgaactatgccggggcg
gactgctcgctggcaggccttgtgccgaccccgtgcctcgagtattccacaagaaagctc
ggatacaggggcggcatcatggtgaccgcctcgcacaacccgcctgaatacaacggcatg
aaagtggtggcgtctgacggcgtcgagatcccccgggaagacgaggagaagatagagggg
atataccgggacaaggcgttccggcccggggagaaatacggtgttatgcgcgcagaagac
ggggccattcctgcataccttgacgggataaaatctcaggtggatgcaagcgccgtgcgc
gcaaggggcccctctgtggtgatagatgccggcaacggggcccaggcggtggctgcgccg
cagctctgcagggatcttggctgcacagtcgaggtgataaacagtgggatagacggagat
tttcccggccgcggcccagaaccgactcctgcaaaccttggcgggctctccgaggctgta
ctgcgcacaggcgcggaccttggggtggcgtttgatggcgacggggatcggagcctgttt
tgcgatgataaaggggaggtcctgacgggggaccgctcggcactcctgctagccggcttt
gtgcttggatcaagcccgggctcggctgtcgtcacatgcctcaactcgggcggggccata
gaaggggtggctgcagggcacggctctcctgtgataaggaccaaggtggggagcgtcgcg
gtatccaggaggatggtctcggaggatgcgcttgtgggctttgaagaaaacggggggttc
atgtacggaaggcacggccaggtgcgggacggggcgatgagccttgcactgatgctcggc
ctggtatcatcgtcggatatgcccctctcttcaatggctgcagccctgccgccgtcgttt
acctcaaaggagaagataccgtgctctgcagcagacgcagagcgcgtgctcgatgtactc
cggtcggagcaccccgaggcggacacgaccgacggcatccggattgcccagggggggagc
tggaccatggtgcggcccagcgggaccgagccgctgatacgggtctatgcagaatcccat
tccgaggcggccctctctgagctgctctcggggcaggtccggaggatacgcgagatacta
gacggcgggtga

DBGET integrated database retrieval system