KEGG   Cenarchaeum symbiosum A: CENSYa_0300Help
Entry
CENSYa_0300       CDS       T01380                                 

Definition
asparagine synthase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
csy  Cenarchaeum symbiosum A
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:csy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(257603..258754)
Genome map
AA seq 383 aa AA seqDB search
MFDMRSSLILWVPASFLASMARSAGMRVLDSISAGSSNDSTMPSCDLKHASPPGQAKLGY
YNSAKGAAAMESMMARLRDELRAAVRACGSKNLALSGGLDSTVIACLLGEGAEAAAVIAD
DFVGTDLAYHQMAAAMMGAPPRIIRATTPEILDAIEGTIRVLGSFNDIEIRNSAAMYLLI
ERVAGTGWTSMITGDGADELFAGYDFFGRLGPAEIEEEQQRILGVMHFDSHRIGKALGVR
IESPFLAPKVAEIARSVPAEYKVREEGGRTYGKWILRKAFEDAIPRAIAWRPKAALQDGS
GTAGLTGLFESVVSDGTFESKRGAIEASDGIRVRSKESLHYYEAYRRIFGKPEPPAGGRP
CPYCRHPVPDGYKFCAMCGAYPA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatatgcggtcctcccttatcttgtgggtgccagccagcttccttgcaagtatg
gcgcggagcgccggtatgagagtcttggattcaatctcggctggaagcagcaatgattcc
accatgccatcttgtgatttaaagcatgcgagtccgccggggcaggccaagctaggctat
tataattccgccaagggagctgccgcaatggagtccatgatggcgcggctgcgcgacgag
ctcagggcggcagtcagggcctgcgggtccaagaacctggcgctctcaggcggcctcgac
agcactgttatagcgtgcctgctaggcgaaggggccgaggcggcggccgtgatagcagac
gactttgtggggacagaccttgcctaccaccagatggcagccgccatgatgggggcgccc
ccgcgcataatccgggccaccactccagagattctcgatgcgatagaggggacgatccgc
gtgctgggcagcttcaacgatatcgaaataagaaactcggctgcaatgtacctgctgata
gagagggtagccggcacggggtggactagcatgataacaggcgacggcgcagacgagctc
tttgcagggtatgactttttcgggcgcctcggccccgcagagatagaagaggagcagcag
agaatcctcggcgtaatgcactttgactcccacaggataggcaaggcgctaggggtgaga
atcgagtcgccctttctggcgccaaaagtggccgagattgcaaggtctgtccccgcagag
tacaaggtaagggaagagggcggcaggacgtacggcaagtggatcctccgcaaggccttt
gaggatgccataccgcgggccatagcgtggaggccaaaggccgctttacaggacggctcc
ggcacggcagggctgacaggcctctttgaatccgtggtctctgacggcacgtttgagtca
aagcggggtgcaatagaggcatctgacgggatcagggtgaggagcaaggagtcgctccac
tattacgaggcgtaccgccggatctttggaaagccggagcccccggcgggcggcaggccg
tgcccttactgcaggcatccggttcccgacgggtacaaattctgcgcaatgtgcggcgcc
tatccggcgtga

DBGET integrated database retrieval system