KEGG   Cenarchaeum symbiosum: CENSYa_0366Help
Entry
CENSYa_0366       CDS       T01380                                 

Definition
hypothetical protein
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
csy  Cenarchaeum symbiosum
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csy00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    CENSYa_0366
Enzymes [BR:csy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     CENSYa_0366
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     CENSYa_0366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(311444..311998)
Genome map
AA seq 184 aa AA seqDB search
MLSTGIASAYDRDPRLIEVILSQTKRIVRMRDGILIVETKGGITCANAGVDESNIQEGHA
ALLPKDPDGSAGRIRREILEKAGRQVAVIISDTFGRPFRMGQTDCAIGVSGMGPITDYIG
TKDTFGRELRVTEMAVADELCGAAEIVMGKASRIPAAVIRNHSVSPGEGSANDLLRPRGE
DLFR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgctatccacggggatagcatccgcgtacgacagagacccgaggcttatagaggtgata
ctctcccagaccaaaagaatagtgaggatgcgcgacggcatcctcatagtggagaccaag
ggagggataacctgcgccaatgcaggggtggacgagagcaacatacaggaggggcacgcg
gccctgctgcccaaggatcccgacgggtccgcgggcagaatccgccgcgagatactcgaa
aaggcgggcaggcaggtagccgtgataatatcggacacgtttggccgccccttcaggatg
ggccagaccgactgcgcgataggcgtctccgggatgggcccgataaccgactatatcggc
accaaggatacgtttggcagggagctgagggtaaccgagatggcagtagccgacgagctg
tgcggcgcggcagagatagtcatgggcaaggcatcccgcataccggcggcagtcatcaga
aaccactctgtgtcccccggcgagggctcggcaaatgacctgctgcgcccccggggagag
gatctcttcaggtga

DBGET integrated database retrieval system