KEGG   Cenarchaeum symbiosum: CENSYa_0532Help
Entry
CENSYa_0532       CDS       T01380                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
csy  Cenarchaeum symbiosum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:csy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CENSYa_0532
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CENSYa_0532
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CENSYa_0532
Enzymes [BR:csy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CENSYa_0532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(464494..465816)
Genome map
AA seq 440 aa AA seqDB search
MNAVLKCIDPGCGLEYPIDSTLVECERGHLLDVKYPGSPPESLKEVFRCRRDPGGSIFNE
SGVWRFRELLNFCSIDTEDAEQCAAHLVSLDGAEGRQSKPYRMGRVSKFTEMEPDSLWLQ
PEGYNPSGSFKDNGMATAVTHARMVSAGKIVCASTGNTSASAGMFAANEGIECDVYIPAG
QIAPGKLSQAYQFGAQIIEVDGNFDDALRRSLDEARGSGGYTVNSINPFRIEGQKTIPYR
ALEQLDWEAPDWIVYPGGALGNTSSCGKALMELHEWGWIGKIPRIAVINAEGARTLSDLY
NDRGLRWNGGKPDTGLIEDHYAEMDRTGAGPRTRATAIQIGRPANILKGLRALEYTDGVV
TTVSDTEMLDGMSAVGLNGFDCEMASGATPAGIKKLVKEGVIKRDDTVVGILTGRQKDAM
LPVEYHSDPSNMFARPPRAR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcggtgctaaaatgcatagacccgggctgcgggttagaatatccgatagacagc
actctagtcgagtgcgagcgcggccacctgctagatgtaaagtatcccggcagcccgcca
gaatccctcaaggaggtcttccggtgcaggagggacccggggggcagcatattcaacgag
agcggcgtgtggcggttccgggagctgctcaacttttgcagcatagacaccgaggatgca
gaacagtgcgcggcacacctggtatcgcttgacggggccgagggcaggcagtccaagccg
taccggatgggcagggtctccaagtttacagaaatggagccggactcgctgtggctgcag
cctgaagggtacaacccgagcggctcgttcaaggacaacggcatggccaccgccgtcacg
catgcaaggatggtctcggcgggcaagatagtgtgcgcctcgacgggcaacacttctgcg
tcagcgggcatgtttgcagcaaacgaggggatagagtgcgacgtgtacataccggcgggc
cagatcgccccgggcaagctcagccaagcctaccagttcggggcccagataatcgaagta
gacggcaactttgatgacgcgctgcggcgctcactcgatgaggcgcgcggcagcggcggc
tacaccgtaaactcgataaacccgttccgcatagagggccaaaagaccatcccgtacagg
gcgctagagcagctcgactgggaggcgcccgactggatagtctaccccggaggtgcgctc
ggcaacacgtcgagctgcggcaaggccctcatggagctgcacgagtggggctggataggc
aagataccccggatagcagttatcaatgcagaaggggcccgcacgctttccgacctgtac
aatgatagaggactccgctggaacggcggcaaacccgataccggtctgatagaggatcac
tatgcagagatggaccggaccggcgcggggccgcggacccgggccaccgccatacagata
ggcaggcctgccaacatactcaaggggctgcgggcgctcgaatatactgacggggttgtc
accaccgtctccgatacagagatgctcgacggcatgtccgcggtcggcctcaacggcttt
gactgcgagatggcctcgggcgccacacccgcggggattaaaaagctcgtaaaagaaggg
gtaatcaagcgcgacgacaccgtagtgggaatactgacaggaaggcagaaagacgcgatg
cttcccgtcgagtaccacagtgatccctccaacatgtttgcaaggccgccaagggcgcgc
tag

DBGET integrated database retrieval system