KEGG   Cenarchaeum symbiosum: CENSYa_0564Help
Entry
CENSYa_0564       CDS       T01380                                 

Definition
dihydroorotate dehydrogenase (EC:1.3.98.1)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
csy  Cenarchaeum symbiosum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CENSYa_0564
   01230 Biosynthesis of amino acids
    CENSYa_0564
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CENSYa_0564
   00030 Pentose phosphate pathway
    CENSYa_0564
   00051 Fructose and mannose metabolism
    CENSYa_0564
  Energy metabolism
   00680 Methane metabolism
    CENSYa_0564
Enzymes [BR:csy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CENSYa_0564
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     CENSYa_0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
492785..494302
Genome map
AA seq 505 aa AA seqDB search
MEYPAVKGLVYNVHLQGYCLAGGIAWPEAENVHPAVAPVRRRREQRACGRSCGGACIRPF
ALLHGLGQHEPPEHKGEHRRKEEHDIDSLCGHRSTPRTSHISALSPAPRCRRGCPWATTH
KSEAVRVPPVRITVSAIKADVGGIGGHTLPSSGLLDAVRRKVSSSSLLIDHYIGYCGDDV
HIVMTHTRGTDNSDIHKLAWDAFMEGTRVAKEEGLYGAGQDLLRDSFSGNVKGMGPGVAE
LEFEERANEAFTVFAADKTEPGAFNYPFYRMFVDSLSNTGLIVNKSLAEGVVINIMDVSK
ARTARLVLWEDKPTIEAALMYPGRFVVSSVETRDGEPIASASTDRLHNIAGTYVGKDDPI
CLVRTQKRFPATEEAGSCFNNPHYVAGNTRGSHHMPLMPVRLNSPASINFCIPIVEALVF
SMHEGRLTGPFDGFSTPDWDDVRRTATRRAHAMRRQGFVHPATLVPDELEYAEGYRSRMD
VLDSKMVPLKDSGPAGTGRAYEDPD
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtggagtatcccgcagtcaaaggactcgtctataatgttcacctccagggatactgcctc
gccggcggcatagcttggcctgaggccgagaatgtccaccctgccgtcgccccggtccgg
cggcgacgagagcagcgggcctgtggccggtcctgcggcggggcttgcatccggcccttc
gccctcctgcatggactgggccagcacgaaccccccgaacacaaaggagagcaccgccgg
aaggaggaacacgacatagacagtctttgtggccatcgttctaccccgcgcacttcccat
atatcagctctaagcccggccccccgatgccgccgcggctgcccttgggcaactacacat
aaatcggaggccgtgcgggtgccgcccgtgaggattaccgtatctgcgataaaggcggac
gtgggcggaataggcggccacaccctgccgagcagcgggctgctggacgccgtccgcagg
aaggtgagctcgtcctccctgctcatagaccactacatcgggtactgcggggacgacgtc
cacatagtaatgacccacacgcggggcaccgacaacagcgacatccacaagcttgcatgg
gatgcctttatggagggcacgcgggtggccaaggaagagggcctgtacggggcgggccag
gacctgctgcgcgattcattttctggcaacgtaaagggcatgggccccggcgtggccgag
ctggagttcgaggagcgcgcaaacgaggcgtttacagtatttgcagcagacaagacagag
cctggcgcattcaactatcccttttacaggatgttcgtcgattcacttagcaataccggc
ctgatagtaaacaagtcgcttgcagaaggcgtcgtcataaacataatggatgtctcaaag
gccaggactgcgaggctggtcctctgggaggacaagccgacaatagaggcagctctgatg
taccccggcaggtttgtagtatcttccgtagagacccgggacggcgagcccatagcatcc
gcatccaccgacaggctccacaacatagcgggcacctacgtgggcaaggacgaccccatc
tgccttgtccggacccagaagaggttccccgctaccgaggaggcgggcagctgctttaac
aatccgcattatgtggcgggcaacacgcgcggaagccaccacatgccgctgatgcccgtg
cggctcaactcgccggctagcataaacttctgcataccgatagtcgaggcgctagtattc
agcatgcacgaaggcaggctgaccggcccgttcgacggcttctcgacccccgactgggac
gatgtgcggaggaccgcgacccggagggcgcacgccatgcggcgccagggctttgtccac
ccggccacgctggtccccgacgagctggaatacgccgaagggtacaggagccggatggac
gtgctggattccaagatggtcccgctgaaggattcggggcctgcaggcacgggccgcgcc
tatgaagaccccgactag

DBGET integrated database retrieval system