KEGG   Cenarchaeum symbiosum: CENSYa_1156Help
Entry
CENSYa_1156       CDS       T01380                                 

Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
csy  Cenarchaeum symbiosum
Brite
Enzymes [BR:csy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CENSYa_1156
Transfer RNA biogenesis [BR:csy03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CENSYa_1156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1190545..1192113
Genome map
AA seq 522 aa AA seqDB search
MQSLGRLDEACTEISRSLLEYESPTSADVRAEIRKACVRYSLKKIPKNREILAAAGGDGF
ERLRHLLLKKPVKTASGVAVIAVMPMPYACPHGRCTYCPGGKASNTPNSYTGGEPIAAGA
MNSGYDPGSQVRAGLARLRAHGHDAAKLEIVIVGGTFLFMPQEYQEWFVKSCYDALNGSA
SSGIEDAKHLNETAAHRNVGLTIETKPDYCKRVHVDAMLGFGATRVEIGVQSLQEEVYKR
VNRGHNYQDVVESFAAAKDAGYKVAAHMMPGLPGATPEGDIEDMRMLFEDPALRPDMLKI
YPALVVRGTPMYDEYARGEYSPYTEEEAVRVLSEAKARVPRWARIMRVQREIHPDEIVAG
PKSGNLRQLVHKRLQEQGRRCRCIRCREAGLAGRTGPRDLRIDRADYAASGGTESFISLV
DNDDAVYGFVRMRRPSIEAHRPEVSPESCIIRELHVYGRSLGLGERGGIQHSGLGRRLVS
EAESVSAEFGAKRLLVISAVGTRGYYSRLGYSRRGPYMEKIL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcgcttggacgactagacgaggcatgcacggagatatcgcgcagcctgctagag
tacgaatcccccacatcagccgacgtccgggcggagatcagaaaggcatgcgtcaggtac
tcgctcaaaaagatccccaagaaccgcgagatactggcggccgccggtggcgacggcttt
gagaggctgcgacatctgctgctcaaaaagcccgtaaagaccgcatccggggtcgccgtg
atagcggtaatgccaatgccgtacgcgtgcccccacggcaggtgcacatactgcccaggc
gggaaggcatcgaacactccaaacagctataccggcggcgagccgatagccgccggcgcc
atgaacagcgggtacgacccgggctcccaggtccgcgcgggcctggccaggctgagggcc
cacggccacgatgcggcaaagctggaaatagtaatagtgggaggaacattcctgttcatg
ccgcaggaataccaggaatggtttgtaaagtcatgctatgacgcgctcaacgggtccgca
tccagtggaatagaagatgccaagcatctcaacgaaacggctgcacatagaaacgtggga
cttacaatagagaccaagccggactattgcaaaagggtccacgtggatgcgatgctcggc
tttggggcaacgcgggtagagattggcgtgcagagtctgcaagaagaggtctacaaaaga
gtcaacagggggcacaactaccaggatgtagtggagtcgtttgctgcagccaaggacgca
ggatacaaggtggccgcccacatgatgccggggctcccgggggccacccccgagggagat
atcgaggatatgcgcatgctgttcgaggacccggcgctcaggccggacatgctcaagata
taccccgcccttgtggtgaggggcacccccatgtatgacgagtatgcaaggggcgaatat
tccccgtataccgaagaggaggcggtccgggtcctctcagaggccaaggcgcgcgtccca
agatgggcgaggataatgcgcgtacagcgcgagatacaccccgacgagatagtggcgggc
cccaaaagcggcaacctccgccagcttgttcacaagaggctccaagagcagggtcgccgc
tgccggtgcatacggtgcagggaggcggggctcgccgggaggacaggcccgagagacctc
cgcatcgacagggcggactatgcggcatcaggtggcacagagtcgtttatctcgctggtg
gataatgacgatgcagtgtacggctttgtgcggatgcggcgcccatccatagaagctcac
aggcccgaagtatcgccggaatcctgcataatacgcgagctgcacgtatacggcaggtcg
cttggactcggcgagaggggcggcatacagcactcgggccttggcaggaggctggtctcc
gaggcagaatccgtatccgcagaatttggcgcgaaaaggctccttgtgataagcgcggta
gggacgaggggatactacagcaggctgggatattcacgcaggggcccctacatggagaag
atactctga

DBGET integrated database retrieval system