KEGG   Cenarchaeum symbiosum: CENSYa_1177Help
Entry
CENSYa_1177       CDS       T01380                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
csy  Cenarchaeum symbiosum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:csy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CENSYa_1177
   01230 Biosynthesis of amino acids
    CENSYa_1177
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CENSYa_1177
   00051 Fructose and mannose metabolism
    CENSYa_1177
   00562 Inositol phosphate metabolism
    CENSYa_1177
Enzymes [BR:csy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CENSYa_1177
Exosome [BR:csy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CENSYa_1177
  Exosomal proteins of bladder cancer cells
   CENSYa_1177
  Exosomal proteins of melanoma cells
   CENSYa_1177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1209091..1209744
Genome map
AA seq 217 aa AA seqDB search
MLIINCKNYKEAAGGRIDSLAAAAAGAAAKYGVRIALAPPQHLLGAVKGEDLTVLAQHID
DKGVGSTTGYVVPELLGESGVSGALINHSEHRVSADQVASLVPRLRGLDMISVVCVKDSA
EAANLSRHRPDYIAIEPPELIGSGRSVSSERPELIGEAAEAIRGADGTKLLCGAGITSGA
DVRKALELGSKGILVASGVVKSSDPAAAIAELAQAMS
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtgctgataataaactgcaaaaactacaaggaggcggccggcggcagaattgacagccta
gcggcggcagccgccggggcggccgcaaaatacggcgtcaggatagctcttgccccgccg
cagcacctgctgggcgcagtaaagggggaagatcttacagttctggcgcagcatatagac
gacaagggggttggaagcaccacaggatatgtcgtgccggagctgctgggagaatccggc
gtctctggcgcgctcatcaaccacagcgagcaccgcgtatcagctgaccaggtggcaagc
cttgtgcccaggctcaggggtctggatatgatctccgtggtctgtgtaaaggattccgcc
gaggcggcaaatctctcccggcaccggcccgactacatagctatcgagcctcccgagctg
ataggctcgggcaggtccgtctcatcggagaggcccgagctgataggggaggcagcagag
gccatcaggggggcggatggaacaaagctgctctgcggggcgggcataacatcaggcgct
gatgtgcgcaaggccctcgagctcggctccaaggggatcctcgtggcaagcggggtggta
aaatcatcagaccccgctgcggccatagccgagctggcacaggccatgtcctga

DBGET integrated database retrieval system