KEGG   Cenarchaeum symbiosum: CENSYa_1177Help
Entry
CENSYa_1177       CDS       T01380                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
csy  Cenarchaeum symbiosum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:csy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CENSYa_1177
   01230 Biosynthesis of amino acids
    CENSYa_1177
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CENSYa_1177
   00051 Fructose and mannose metabolism
    CENSYa_1177
   00562 Inositol phosphate metabolism
    CENSYa_1177
Enzymes [BR:csy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CENSYa_1177
Exosome [BR:csy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CENSYa_1177
  Exosomal proteins of bladder cancer cells
   CENSYa_1177
  Exosomal proteins of melanoma cells
   CENSYa_1177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1209091..1209744
Genome map
AA seq 217 aa AA seqDB search
MLIINCKNYKEAAGGRIDSLAAAAAGAAAKYGVRIALAPPQHLLGAVKGEDLTVLAQHID
DKGVGSTTGYVVPELLGESGVSGALINHSEHRVSADQVASLVPRLRGLDMISVVCVKDSA
EAANLSRHRPDYIAIEPPELIGSGRSVSSERPELIGEAAEAIRGADGTKLLCGAGITSGA
DVRKALELGSKGILVASGVVKSSDPAAAIAELAQAMS
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtgctgataataaactgcaaaaactacaaggaggcggccggcggcagaattgacagccta
gcggcggcagccgccggggcggccgcaaaatacggcgtcaggatagctcttgccccgccg
cagcacctgctgggcgcagtaaagggggaagatcttacagttctggcgcagcatatagac
gacaagggggttggaagcaccacaggatatgtcgtgccggagctgctgggagaatccggc
gtctctggcgcgctcatcaaccacagcgagcaccgcgtatcagctgaccaggtggcaagc
cttgtgcccaggctcaggggtctggatatgatctccgtggtctgtgtaaaggattccgcc
gaggcggcaaatctctcccggcaccggcccgactacatagctatcgagcctcccgagctg
ataggctcgggcaggtccgtctcatcggagaggcccgagctgataggggaggcagcagag
gccatcaggggggcggatggaacaaagctgctctgcggggcgggcataacatcaggcgct
gatgtgcgcaaggccctcgagctcggctccaaggggatcctcgtggcaagcggggtggta
aaatcatcagaccccgctgcggccatagccgagctggcacaggccatgtcctga

DBGET integrated database retrieval system