KEGG   Cenarchaeum symbiosum: CENSYa_1275Help
Entry
CENSYa_1275       CDS       T01380                                 

Definition
tryptophan synthase alpha chain (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
csy  Cenarchaeum symbiosum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CENSYa_1275
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CENSYa_1275
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CENSYa_1275
Enzymes [BR:csy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CENSYa_1275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1293558..1294337)
Genome map
AA seq 259 aa AA seqDB search
MAYMMAGYPPGRDLEVLRGLARGGADIIEVGFPFSDPLADGPVIRDAAAESIRGGMDRKN
LLEFVRRARGETDVPLVLMTYANVLYRRGLCRFMREAASAGIDGFIIPDLPVEEAAEYLE
CAKKEDAAAILLASPNTGPERMREIASASSGFLYVVAVYGTTGAAGGVKEYAVRAVRRAL
KESGGLPVGAGFGVSGPKDVARFVDAGADAVIVGSAILKLAGTGGAGLEGRIADFTAGLK
QATIPRGRSSRSAGGAGRR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtggcctatatgatggcaggctaccccccggggcgggacctcgaggtgctccgcgggctg
gcccgcgggggcgccgacatcatcgaggtgggctttccattctccgacccgctggccgac
gggcccgtaatccgggacgcggcagcagagtccatccgcggcggcatggacagaaagaac
ctgctggagtttgtgcggcgggcccgcggcgagaccgatgtccccctggtcttgatgacc
tatgccaacgtactgtacaggaggggcctgtgcaggttcatgcgggaggctgcatctgca
ggaatagacgggttcataatccccgacctgccggtagaagaggcagccgagtatcttgaa
tgcgcaaaaaaagaggatgctgccgccatactgcttgcatcgccaaatacgggccccgaa
agaatgcgcgagatagcctcagcgtccagcggctttctgtacgttgtggcagtctacggc
actactggcgcggcaggcggcgtaaaggagtatgcggtccgcgctgtgcgcagggccctc
aaggaatcgggcgggctgcccgtaggcgcgggctttggggtctcggggccgaaagatgtg
gcaaggtttgtagacgcaggcgcagatgctgtcatagtgggcagcgccatactgaaactg
gcaggtacagggggggcgggcctggagggccgcatagcagactttacggcgggcctgaaa
caggccaccatcccgcgcggcagatcatcgcgatctgccggcggggcggggcgccgctaa

DBGET integrated database retrieval system