KEGG   Cenarchaeum symbiosum: CENSYa_1275Help
Entry
CENSYa_1275       CDS       T01380                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
csy  Cenarchaeum symbiosum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CENSYa_1275
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CENSYa_1275
Enzymes [BR:csy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CENSYa_1275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1293558..1294337)
Genome map
AA seq 259 aa AA seqDB search
MAYMMAGYPPGRDLEVLRGLARGGADIIEVGFPFSDPLADGPVIRDAAAESIRGGMDRKN
LLEFVRRARGETDVPLVLMTYANVLYRRGLCRFMREAASAGIDGFIIPDLPVEEAAEYLE
CAKKEDAAAILLASPNTGPERMREIASASSGFLYVVAVYGTTGAAGGVKEYAVRAVRRAL
KESGGLPVGAGFGVSGPKDVARFVDAGADAVIVGSAILKLAGTGGAGLEGRIADFTAGLK
QATIPRGRSSRSAGGAGRR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtggcctatatgatggcaggctaccccccggggcgggacctcgaggtgctccgcgggctg
gcccgcgggggcgccgacatcatcgaggtgggctttccattctccgacccgctggccgac
gggcccgtaatccgggacgcggcagcagagtccatccgcggcggcatggacagaaagaac
ctgctggagtttgtgcggcgggcccgcggcgagaccgatgtccccctggtcttgatgacc
tatgccaacgtactgtacaggaggggcctgtgcaggttcatgcgggaggctgcatctgca
ggaatagacgggttcataatccccgacctgccggtagaagaggcagccgagtatcttgaa
tgcgcaaaaaaagaggatgctgccgccatactgcttgcatcgccaaatacgggccccgaa
agaatgcgcgagatagcctcagcgtccagcggctttctgtacgttgtggcagtctacggc
actactggcgcggcaggcggcgtaaaggagtatgcggtccgcgctgtgcgcagggccctc
aaggaatcgggcgggctgcccgtaggcgcgggctttggggtctcggggccgaaagatgtg
gcaaggtttgtagacgcaggcgcagatgctgtcatagtgggcagcgccatactgaaactg
gcaggtacagggggggcgggcctggagggccgcatagcagactttacggcgggcctgaaa
caggccaccatcccgcgcggcagatcatcgcgatctgccggcggggcggggcgccgctaa

DBGET integrated database retrieval system