KEGG   Cenarchaeum symbiosum: CENSYa_1275Help
Entry
CENSYa_1275       CDS       T01380                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
csy  Cenarchaeum symbiosum
Pathway
csy00260  Glycine, serine and threonine metabolism
csy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
csy01100  Metabolic pathways
csy01110  Biosynthesis of secondary metabolites
csy01130  Biosynthesis of antibiotics
csy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CENSYa_1275
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CENSYa_1275
Enzymes [BR:csy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CENSYa_1275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth DHO_dh IMPDH ThiG NanE FMN_dh
Motif
Other DBs
NCBI-ProteinID: ABK77898
UniProt: A0RX31
Position
complement(1293558..1294337)
Genome map
AA seq 259 aa AA seqDB search
MAYMMAGYPPGRDLEVLRGLARGGADIIEVGFPFSDPLADGPVIRDAAAESIRGGMDRKN
LLEFVRRARGETDVPLVLMTYANVLYRRGLCRFMREAASAGIDGFIIPDLPVEEAAEYLE
CAKKEDAAAILLASPNTGPERMREIASASSGFLYVVAVYGTTGAAGGVKEYAVRAVRRAL
KESGGLPVGAGFGVSGPKDVARFVDAGADAVIVGSAILKLAGTGGAGLEGRIADFTAGLK
QATIPRGRSSRSAGGAGRR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtggcctatatgatggcaggctaccccccggggcgggacctcgaggtgctccgcgggctg
gcccgcgggggcgccgacatcatcgaggtgggctttccattctccgacccgctggccgac
gggcccgtaatccgggacgcggcagcagagtccatccgcggcggcatggacagaaagaac
ctgctggagtttgtgcggcgggcccgcggcgagaccgatgtccccctggtcttgatgacc
tatgccaacgtactgtacaggaggggcctgtgcaggttcatgcgggaggctgcatctgca
ggaatagacgggttcataatccccgacctgccggtagaagaggcagccgagtatcttgaa
tgcgcaaaaaaagaggatgctgccgccatactgcttgcatcgccaaatacgggccccgaa
agaatgcgcgagatagcctcagcgtccagcggctttctgtacgttgtggcagtctacggc
actactggcgcggcaggcggcgtaaaggagtatgcggtccgcgctgtgcgcagggccctc
aaggaatcgggcgggctgcccgtaggcgcgggctttggggtctcggggccgaaagatgtg
gcaaggtttgtagacgcaggcgcagatgctgtcatagtgggcagcgccatactgaaactg
gcaggtacagggggggcgggcctggagggccgcatagcagactttacggcgggcctgaaa
caggccaccatcccgcgcggcagatcatcgcgatctgccggcggggcggggcgccgctaa

DBGET integrated database retrieval system