KEGG   Cenarchaeum symbiosum: CENSYa_1276Help
Entry
CENSYa_1276       CDS       T01380                                 

Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
csy  Cenarchaeum symbiosum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CENSYa_1276
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CENSYa_1276
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CENSYa_1276
Enzymes [BR:csy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CENSYa_1276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1294375..1295490)
Genome map
AA seq 371 aa AA seqDB search
MPAVRELEEAYADARADPAFDDELGCLLREYAGRPTPLYLAKNLTKKAGGARIYLKREDL
LHGGAHKINNTLGQALLAKRMGKRRIIAETGAGQHGVATAMACACLGIHSEVYMGSKDAE
RQSLNVYRMRLLGSEVHRVDSGARTLKDAINEAIRDWITRVRDTYYLLGSAVGPHPYPAM
VRDFQSVIGREIIEQMGGAPDAAVACVGGGSNAIGTFHPLLGIGTRLVGVEAAGRGLGSG
EHSAPLSAGSRGVLHGMMTYLLQDKEGQVGEAHSISAGLDYPGVGPEHAYLKDAKKAEYT
SATDKEAVAAFMLLAKTEGIIPALESAHAVAGALKLARKMPSSESVVVTLSGRGDKDVQV
VQEYAGLEDSG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcggtacgggaacttgaagaagcatacgcggacgcgcgcgcggaccctgcattt
gatgacgagctcggctgcctgctccgggagtacgcggggcgccccacgccgctctacctt
gcgaaaaacctgacaaaaaaggcgggtggcgcgcgcatatacctaaagagggaggatctt
ttgcacggaggggcgcacaagataaacaacacgctgggacaggccctgctggcaaaaaga
atgggcaagcggcggatcatagccgagactggcgccggccagcacggcgtggccacggcc
atggcgtgcgcctgccttgggatccactcggaggtgtacatggggtccaaggacgcggaa
cggcagagccttaacgtataccgtatgcgcctgctgggatccgaggtgcaccgggtggat
tcaggcgccaggacgctaaaagacgcgataaacgaggcgatcagggactggataacccgc
gtccgggacacatactatctgttgggatcggccgtggggccgcacccgtatcccgcaatg
gtccgcgattttcagagcgtgataggcagggagattatcgaacagatggggggcgcgccc
gacgcggcagtagcatgcgtcgggggcggctcaaacgcaatagggacgtttcatccgctg
ctgggaattggcacaaggctggttggagtagaggctgcgggccgcggcctcggctcgggc
gagcactcggcgccgctctcggctggcagccggggcgtactgcacgggatgatgacgtac
cttttgcaggacaaggaaggccaggtaggcgaggcccacagcatatccgcggggctcgac
tatcccggcgtgggccccgaacatgcatacctcaaggatgcaaaaaaggcagagtacaca
tcggcaaccgacaaggaggcagtagccgcgtttatgctgctggcaaaaacagaggggata
attcccgcccttgaatcggcacacgcggtggcgggggccctgaagctggcgcgaaagatg
ccgagctcggaatcggtggtggttacgctctccggaaggggcgacaaggacgtgcaggtg
gtgcaggaatatgcagggctcgaggatagcggctag

DBGET integrated database retrieval system