KEGG   Cenarchaeum symbiosum: CENSYa_1354Help
Entry
CENSYa_1354       CDS       T01380                                 

Definition
uroporphyrinogen-III synthase/methyltransferase (EC:2.1.1.107 4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
csy  Cenarchaeum symbiosum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CENSYa_1354
Enzymes [BR:csy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CENSYa_1354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1380559..1381338)
Genome map
AA seq 259 aa AA seqDB search
MNGRTIAITRSPEDSAQFAELAARDGARAMPLPTIELVPRDDMVDSTLREISENDPDYTV
FMSSKAVRLLFDAAESESKLEKLQLAVANTSVVAVGPVTRGALEGRGIRVAHTPERYSSV
GVGEVFSALGAEGKKVFVPRSGASTPFLRDLLTKMGLDVHELHLYDVRASGGPQWDEFRE
LLPRGGIDGIVFTSASSVRAFFELMHGAELPEGIRAVAIGPFTADELAKFGVEHTIAGVH
TVPGAFDAIKSALAAGGAT
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaaggacaatagcaataacaaggtcccccgaggattcggcgcagtttgccgag
cttgcggccagggacggcgcgcgcgcaatgccgcttcccaccatagagcttgtcccgcgg
gatgacatggtggacagcacgctgcgcgaaatatcggaaaacgatcctgattacaccgtc
tttatgagctcaaaggccgtgcggctgctattcgatgcagccgagtcggaatcaaaactt
gaaaagctgcagctcgccgtcgccaacacgtcggttgtggcggtgggccccgtgacgcgc
ggcgcactcgagggccgcggcataagggttgcgcacacgccggaaagatactcgtcggtc
ggcgtcggcgaggttttttccgcgcttggcgccgagggcaaaaaggtgtttgtcccgcgg
agcggcgcatcgactccgtttttgcgcgaccttttgacaaagatggggctagatgtgcat
gagctgcatttgtacgacgtgcgggcgtcgggcggccctcaatgggacgagttccgggag
ctgcttccgcggggcggcatagacgggatagtctttactagcgcgtcgtcggtgcgcgcg
ttctttgagctgatgcatggagcggagctgccggaggggatcagggccgtggcgataggc
ccgtttaccgcagacgagcttgcaaagttcggggtggaacatacgatcgcaggcgtccat
acggtgcctggcgcctttgatgcgatcaagtcagcgcttgccgcaggcggggcgacttag

DBGET integrated database retrieval system