KEGG   Cenarchaeum symbiosum A: CENSYa_1586Help
Entry
CENSYa_1586       CDS       T01380                                 

Definition
Mg-chelatase subunit (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
csy  Cenarchaeum symbiosum A
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:csy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1596935..1598692)
Genome map
AA seq 585 aa AA seqDB search
MIQAPMHEFNILRPSTQLPPPGPHTGPPYRPARGPQCYKFPYWRVCLLAPDVRSMVESSY
SAEPAYKEVRAGTPEEYGDITTLGGLLDANYKLPSSREQVRRNLLSMGRGAYPGIIGFDD
DVIPALDRALLSGHDTFLIGQMGQAKTRLVRSIAENLLSPIPVIRNSATNDCPMDLPAAD
LADALEGTGGSSRPVFHVSPESLEVLRERGLETPVEWLGGARRFRYVLATPDTTVRDLVG
SIDAVKVAKKGTEMYRIDSYSPGQLMQAKHGIFCIDELPVLDPRKQVALLSVLQEGRFTT
GPYPVYFEPRTMLFATANPVDYTHSGRVIEPLLDRLASHVHTHYPPTIHDEMMIIMQEAR
LPPAAVAELPLRALAGVIAGMRNSGQINQERGVSARTGIHGLEILVSEAERTRPTAAGAL
PAPRLSDFHALEQVAKFELTELDDTVENRARVFAEIMDAAVGDACLGLLEGTVDEELQLI
KDEFGAGTFRSSQEMQWSGGADPYERQMADHPLLSKLLESRLEMALEAQAKLVADLGEHG
IQAKAADIGQDHDGLRAVLLEGLLEGLCHTKPRMLERRDAGYSPA
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgatacaggcacccatgcatgaatttaacattttgcggccatcaacgcaacttccgccc
cccgggccacacacaggccccccgtacaggcccgcaagggggccgcaatgttataaattc
ccgtactggcgggtgtgcctgttggcccccgatgtgcgatccatggtggagagtagctac
tctgcagagcctgcatacaaggaggtccgggcgggcacccccgaggaatatggcgatatc
actacactcggcggcctgctggatgcaaactacaagctgccctcctcccgggagcaggtc
cggcgcaacctgttatccatgggcaggggcgcgtaccccgggataatcggctttgatgac
gatgtaatacccgcgcttgacagggccctgctgtcggggcacgacaccttcctcataggg
cagatgggccaggcaaagacaaggctggtccgctcgatagccgagaacctcctctcgccc
atccccgtgattcgaaacagcgcaaccaacgactgccccatggacctgccggcagccgac
cttgcggacgcattggaaggaaccggaggatcctcccgcccggtcttccatgttagcccc
gagagcctggaggtgctgcgtgagaggggactcgagactcccgtcgagtggctcggcggc
gcgcgcaggttccggtacgtgcttgccacccccgatacaacagtgagggaccttgtcggc
agcatagacgcagtcaaggttgcaaaaaagggcactgaaatgtacaggatagactcgtac
tcgccgggccagctgatgcaggcaaagcacggcatattctgcatagacgagctgcccgtc
cttgatccgcgcaagcaggtcgccctgctctcggtgctccaggagggcaggtttaccacc
ggcccgtaccccgtgtactttgagccgaggaccatgctctttgcgacggcaaaccccgtc
gactatacccactcgggcagggtgatagagccgctccttgaccgcctggcaagccacgtc
cacacgcactatccccccaccatccacgacgagatgatgatcataatgcaggaggcccgc
ctgccgcctgccgcggttgcagagttgccgctcagggcgctggctggggtgatagccggg
atgcgaaacagcgggcagataaaccaggagaggggggtgagcgcacgtaccggcatacac
gggctcgagatactcgtatccgaggcggagcggacaaggcctaccgcggccggcgccctg
ccggcgccccgcctgtccgactttcatgcgctagaacaggtggccaagtttgagctcacc
gagctcgacgataccgtagagaacagggcgcgcgtatttgccgagataatggatgccgca
gttggggatgcgtgcctcgggctgctcgagggaacagtagatgaagagctgcagctgatc
aaggacgagtttggcgccgggacgttcaggtcctcgcaggagatgcagtggtccggcggg
gcagacccgtatgaacgccagatggcagaccacccgctcctgtccaagctgctcgaatcc
cgcctcgagatggcgctagaagcgcaggcaaagctggtggcggatctcggagagcacggc
atacaggccaaggcggccgacataggacaggatcacgacgggctgcgcgccgtgcttcta
gaggggctcctcgagggcctctgccatacaaagccccgcatgctggagaggcgcgatgcc
ggatactcgcccgcgtga

DBGET integrated database retrieval system