KEGG   Cenarchaeum symbiosum A: CENSYa_1881Help
Entry
CENSYa_1881       CDS       T01380                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
csy  Cenarchaeum symbiosum A
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:csy00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1853945..1854727)
Genome map
AA seq 260 aa AA seqDB search
MITPPVRGGMPELGRALEAAERAGRAVMDVYRTEFEHDTKADGSPVTGADLASNQVIREM
LEGSGHRILSEEDADDGSRLGERTLWIVDPLDGTSDFVDRTGEFTVMIALVRDGRPILGV
IGWPDGGELYAAQKGAGAFRYSGGRWEGIRASDAGEIGRSKAVGSRHHLSEREKEAMARL
GVGSFEGVGSSLKACRIACGEADLYFTYTDKMCEWDSAASSCIVAEAGGDDHRYKRRHDH
VQPQRCEASGRDGHEQRRPA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgccccccgtcagggggggcatgccggaactcggccgggcgctggaggccgca
gagagggccgggcgcgcggtcatggatgtataccggaccgagtttgagcacgatacaaag
gccgacgggtcccccgttacaggggccgacctggcaagcaatcaagtgatcagggagatg
ctggagggctcggggcaccgcatactctccgaggaggacgcagacgacgggtcaagactc
ggggagaggactctgtggatagtggatccgcttgatggcacatcagactttgtggacagg
acaggcgagtttacggtgatgattgcgctggtgcgcgacggcaggcccattctcggcgtg
atagggtggcccgacggcggggagctctatgcagcacagaaaggtgcgggggcgttcagg
tattccggcggcaggtgggaggggatccgcgccagcgatgcaggcgagatcggcaggtcc
aaggccgtgggcagcaggcaccacctgtcggagagggagaaggaggcgatggcaaggctc
ggggtgggcagctttgagggcgtgggcagctccctcaaggcgtgcaggatagcgtgcggc
gaggccgacttgtactttacgtacacggacaaaatgtgcgaatgggactctgccgcgtca
agctgcatagtggccgaggccgggggggatgatcaccgatacaaaaggcgacatgatcac
gtacaaccacaaagatgtgaggcatcaggacgggatggtcatgagcaacggcgtcctgca
tga

DBGET integrated database retrieval system