KEGG   Cenarchaeum symbiosum A: CENSYa_1893Help
Entry
CENSYa_1893       CDS       T01380                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
csy  Cenarchaeum symbiosum A
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:csy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1862589..1863158
Genome map
AA seq 189 aa AA seqDB search
MDTKRVEKLVRELIIELGEDPTREGLRETPARMARMYGEIFGGYESDAELSVQFSEDSDA
VVARDIGFYSVCEHHMLPFFGSIHIAYLPDGKVFGVSKLVRLVEKYSRRLQIQERLTRNI
ADELSSQGVKGVAVVAEAEHLCMKMRGVRSDARLTSSAFRGAYKDADAREGVMAMIRGRM
PDPGRMLKN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggacacaaagcgggtcgagaagctggtcagggagctcataatcgagctgggcgaggac
ccaacccgggagggcctccgggagacgccggcccggatggccaggatgtacggcgagata
ttcggcggatacgaatccgacgcagagctctccgtccagttctctgaggattcagacgcc
gtggtggcccgggacatcgggttctactcggtctgcgagcaccacatgctgccgttcttt
ggcagcatccacatagcctacctgcccgacgggaaggtattcggggtctccaagctggta
aggctggtagaaaagtactcgaggcgcctgcagatacaggagcgcctgacccggaacatc
gccgacgagctcagctcccagggggtcaagggcgttgcagtggtggccgaggccgagcat
ctctgcatgaagatgaggggcgtccgcagcgacgccaggctgacctccagcgcgttcagg
ggtgcctacaaggatgccgacgcccgggagggcgtcatggccatgatccgcggcaggatg
cccgatccgggccgcatgctcaaaaattaa

DBGET integrated database retrieval system