KEGG   Cenarchaeum symbiosum: CENSYa_2036Help
Entry
CENSYa_2036       CDS       T01380                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
csy  Cenarchaeum symbiosum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CENSYa_2036
  Amino acid metabolism
   00340 Histidine metabolism
    CENSYa_2036
Enzymes [BR:csy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     CENSYa_2036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1999015..2000283
Genome map
AA seq 422 aa AA seqDB search
MIRIARVRDAEKFASSARPRIPEHRRKDVQKIIEYIRKGGDAALQKTEARFGSRVSSFRV
TKKEIQAAYSIISRQELAAVKASKIALERTERATLSGLNGTVMRHKGTIIHRGYSPISSV
GCYVPGGLAKYPSSAIMSVVPARIAGVPRIVVATPPDRSGSIDPLTLVAADACGATEIYK
TGGAQAVAALSYGTRTIHPVDKIVGPGGLYVTLAKSLVSGDTAIDMLAGPTELAILADSS
SDARHIAADLISQAEHSSDTSCYVITNSASKAREIDGILSDRMRGMPRSGIIRPALKNNG
FIAVCTTMDAMVKLANMMAPEHLEVLTKKPRNIADRIRTAGLVLVGPYTPSSASDYMLGT
NHILPTGGSGRARGSLSVLDFLRLDTQVESTRAGLRRISGHLRTLSAAEGLDSHHKAVEE
RL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttgatacggatagcaagggtacgtgacgccgaaaagttcgcgtcatctgcaaggccccgc
ataccagaacaccgcaggaaagatgtgcaaaagattatcgaatatatcagaaaggggggc
gatgcggcactccaaaaaacagaggcgcgctttggctcccgggtgagctccttccgggtg
acaaaaaaagagatacaggcggcatactctataatctcaaggcaggagcttgccgctgta
aaagcctccaagatagcactcgagaggaccgagcgggccaccctctccgggctgaacggg
acggtcatgcggcacaaaggcaccataatacacaggggctactcccctatctccagcgtc
ggatgctacgtgccagggggtctggcaaagtatccaagctctgcgataatgtcggttgtt
cccgcaagaatagcgggtgtgccccggatagtggtggccaccccgccggatagaagcggc
agcatagacccccttaccctggtggcggccgatgcctgcggtgcgaccgagatatacaag
acgggcggggcccaggcggtggccgccctctcctacggcacaaggaccatccatccagta
gacaagatagtggggcccgggggcctgtatgtaaccctggcaaagtcgcttgtcagcggg
gatactgcaatagacatgctggcgggccccaccgaactggccatactggcggattcctcc
tccgatgcccggcatatagcggccgatctaatctcccaggcagagcacagcagtgacacg
tcttgctatgtaataacgaactctgcatcaaaggcccgcgaaatagacggcattctctcg
gataggatgcgtggcatgccccgctctggtataatccggccggccctcaaaaataacgga
tttatcgccgtgtgtaccacgatggatgccatggtaaagcttgccaatatgatggccccg
gagcaccttgaggtgctcaccaaaaagccgcgcaatatagcagataggataaggacagcg
ggccttgtactggtgggcccgtacacgccatcttctgcgagcgactatatgctcggcacc
aaccatatactgcccaccggcggctcgggcagggccaggggctcgctctcggtactggac
tttctaaggctggatacacaggtagagtccacccgggctggactgcgccgcatatcgggg
cacctgcggacgctctctgcagcagagggcctggatagccaccataaggcagtggaggaa
aggctgtga

DBGET integrated database retrieval system