KEGG   Cenarchaeum symbiosum: CENSYa_2045Help
Entry
CENSYa_2045       CDS       T01380                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
csy  Cenarchaeum symbiosum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:csy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CENSYa_2045
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CENSYa_2045
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CENSYa_2045
Enzymes [BR:csy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CENSYa_2045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2005985..2007223
Genome map
AA seq 412 aa AA seqDB search
MISRMIPRLNSIHLECRECGKIHEPDFRYVCEDCFGPLDVRYDGVSVNRDTFSGRAHTYW
RYYEMLPILDKSHIVDIGSGMTPLMRADRLGDELGLKNLYIKNDSVNPTFSFKDRPAGVA
VSKATELGLKAVGCASTGNLASATAAHAAKAGLPCHVFAPGDIEVPKIAQALSYGANFVA
VDGTYDDSNRIAAQIGEQKGIGIVNINLRSYYVEGSKTLAYEVAEQLNWEVPDRLVVPVG
SGAMLNAICKGFEELDELGLLGDVSSMRMVAAQPLGCAPVVDAYRKNQDIVQPVERPETV
AKSLAIGDPGDGRYVLKRLKQYKGHAEDSNDREILNGITLLARTEGIFTEPAGGVAVAVL
KKMVEDGKIDRDEKVVCYITGNGLKATEPLMEVLPKLDVMKADVEAISAVVK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgaggatgatccctagattgaacagcatacatctagaatgcagggaatgcggc
aagatacacgagcccgactttaggtatgtctgtgaagattgctttgggccgcttgatgtc
agatatgacggggtgtctgtgaacagggatacgttctctggcagggctcatacatactgg
agatattacgagatgctgcccatactggataaatcgcatattgtcgatataggatcaggg
atgacgcctttgatgcgcgcagaccgtttaggtgatgagctggggttgaagaatttgtat
atcaagaatgattctgtaaatccaacgttttcattcaaggacaggcctgccggggtggcc
gtatcaaaggctaccgagcttgggctcaaggcggtagggtgcgcatctactggtaatttg
gcgtctgcaactgctgctcatgctgccaaagctggccttccatgccatgtctttgcgccc
ggggatatagaggtgccaaagatagcgcaggcattatcgtacggggcaaactttgtggca
gtagacggcacatacgatgattccaacaggatagccgcccagataggcgagcagaaaggg
ataggaatagtgaacattaacctgcgctcgtattacgtagagggctccaagacgctggcg
tatgaagtggcggaacagctgaactgggaggtgccagatagactggttgttcctgtaggc
agcggcgccatgctaaatgctatctgcaagggctttgaggagctcgacgagctgggcctc
ttgggagatgtttcttcaatgaggatggtggctgcgcagccactgggatgtgctcctgta
gtggatgcgtatagaaagaaccaggatatagtccagccggtcgagaggccggagaccgtg
gccaagagtttagccataggggatcccggggatggcaggtatgtactcaagaggctaaag
cagtacaaggggcatgcagaagattccaacgatcgcgagatattaaacgggataacactg
cttgccaggacagaggggatatttacagaacctgcagggggagtagccgtggctgtattg
aaaaagatggtcgaggatggcaagatagacagggatgagaaggttgtctgttatatcacg
ggcaatggcctcaaggcaacagagcccctcatggaggtgcttccaaagctcgatgtgatg
aaggcagatgtggaggccatatcggcggtggtaaaataa

DBGET integrated database retrieval system