KEGG   Cronobacter sakazakii Sp291: CSSP291_01715Help
Entry
CSSP291_01715     CDS       T02461                                 

Definition
Fels-2 prophage: prophage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
csz  Cronobacter sakazakii Sp291
Brite
Enzymes [BR:csz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     CSSP291_01715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
334938..335453
Genome map
AA seq 171 aa AA seqDB search
MSPSIVKRCLVGAVLAIAATLPGFQSLHTSVEGLKLIADFEGCRLQPYQCSAGVWTDGIG
NTSGVVPGKTITERQAAQGLINNVLLTEKRIEACLQVKPPQHVYDALISIGFNVGTGAIC
RSTMVSYINRQQWWQACNQLPRWVYVNGQRNKGLENRRARELAWCLKGAGA
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgagtccttcaatcgttaagcgttgcctggtcggcgcggtgctggcgattgccgccacg
ctgccaggctttcagtcgcttcatacctccgttgaggggctgaaactgattgctgatttc
gaagggtgccgcctgcagccataccagtgcagcgccggggtctggactgacgggatcggc
aatacgtccggggtagtgccgggcaaaaccataacggagcgacaggccgcgcaggggctg
attaataacgtattgctgacggaaaaaaggattgaagcctgcctgcaggttaaaccacct
cagcatgtttacgatgccctgatcagtatcggctttaatgtcggaaccggggccatctgc
cggtcaacaatggtttcttacatcaatcgccagcagtggtggcaggcgtgcaaccagctc
ccccgctgggtttatgtaaatggtcaacggaataaagggctggaaaacaggcgcgcccgt
gagcttgcctggtgtcttaaaggggcaggggcatga

DBGET integrated database retrieval system