KEGG   Cronobacter sakazakii Sp291: CSSP291_02240Help
Entry
CSSP291_02240     CDS       T02461                                 

Definition
protein disulfide isomerase II DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
csz  Cronobacter sakazakii Sp291
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
440013..440732
Genome map
AA seq 239 aa AA seqDB search
MKKTIALLSVTLAAFSGFAQADDAAIKQSLTKLGVANAEIQPSPLAGMKTVLTESGVIYV
TEDGKHIIQGPLYDVSGGQPVNVTNQMLMTKLNALEKEMIVYKAPQEKHVITVFTDITCG
YCHKLHEEMKDYNALGITVRYLAFPRQGPRSETAKDMQAIWCAKDRNKAFDNAMSGGKVE
AASCDVDTAKHYELGVQFGVQGTPAIVLSNGAMVPGYQGPKEMKAFLDEHQKQLQASGK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaactattgcgctgctctccgttacgctggcggctttttcaggatttgcccag
gcggatgacgcggccatcaaacagtcactcaccaaactgggtgtggcaaatgccgaaatt
cagccctctccgctggcaggcatgaaaaccgtactgaccgaaagcggcgttatctatgtc
accgaagacggcaaacatatcattcagggcccgctgtatgacgtcagcggcggccagccg
gtcaacgtgaccaatcagatgctgatgaccaaactcaacgcgctcgaaaaagagatgatt
gtttataaagcgccgcaggaaaaacatgtcatcaccgtctttaccgatatcacctgtggc
tattgccataagctgcacgaagagatgaaagactataacgcgctgggcatcaccgtgcgc
tacctggctttcccgcgtcaagggccgcgcagcgaaacagcgaaagatatgcaggctatc
tggtgcgcgaaagatcgtaataaagccttcgataacgcgatgagcggcggcaaagttgaa
gcggcaagctgcgacgtcgacaccgcgaaacattatgagctcggcgtgcagtttggcgtc
cagggcacaccggcgatcgtgctgagcaacggtgcgatggtgccgggctatcaggggcca
aaagagatgaaagcgtttcttgatgagcatcagaaacagcttcaggcgagcggaaagtaa

DBGET integrated database retrieval system