KEGG   Cronobacter sakazakii Sp291: CSSP291_04705Help
Entry
CSSP291_04705     CDS       T02461                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
csz00220  Arginine biosynthesis
csz00250  Alanine, aspartate and glutamate metabolism
csz00290  Valine, leucine and isoleucine biosynthesis
csz01100  Metabolic pathways
csz01110  Biosynthesis of secondary metabolites
csz01130  Biosynthesis of antibiotics
csz01210  2-Oxocarboxylic acid metabolism
csz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csz00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CSSP291_04705
   00290 Valine, leucine and isoleucine biosynthesis
    CSSP291_04705
   00220 Arginine biosynthesis
    CSSP291_04705
Enzymes [BR:csz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     CSSP291_04705
    2.6.1.66  valine---pyruvate transaminase
     CSSP291_04705
Amino acid related enzymes [BR:csz01007]
 Aminotransferase (transaminase)
  Class I
   CSSP291_04705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGE85538
Position
complement(978162..979376)
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSSKLDNVCYDIRGPVLKEAKRLEEEGQKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARDMRDVTVEDIYIGNGVSELIVQAMQALLNTGD
EMLVPAPDYPLWTAAVSLSGGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLLDIVEIARQHNLIIFADEIYDKILYDDAQHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
VPGGRLYEQRNRAWELINEIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHVRIVTLPRIDELDLAITKLGRFLSGYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccatcgaaaaatccagtaagctcgacaatgtctgttatgacatccgcggcccg
gtgcttaaagaggccaaacgccttgaagaggaaggtcaaaaagttcttaagctgaacatc
ggtaacccggcgccttttggctttgacgcgccagatgagattcttgttgatgtcatccgc
aacctgcccaccgcgcagggctactgcgactctaaagggctctactccgcccgcaaagct
atcatgcagcactaccaggcgcgcgacatgcgcgatgtgacggtcgaagatatctatatc
ggcaacggcgtgtcagaactgatagtccaggcaatgcaggcattattgaacaccggcgac
gaaatgctggtgcctgcgcccgattatccgctgtggaccgcggcggtgtcgctctccggc
ggcaaagcggtgcattatctttgcgacgaatcctccgactggttcccggatctcgacgac
atccgcgctaaaatcacgccgcgcactcgcgggattgtcatcatcaacccgaacaacccg
accggcgcggtctattcgaaagaactgctgctggacatcgttgagattgcccgtcagcac
aacctcatcattttcgccgacgaaatctacgacaagatcctctacgatgacgcgcaacac
cactcgatcgccgcgctggcaccggatctgcttaccgtcacctttaacggtctttctaaa
acctaccgcgtagcgggtttccgtcagggctggatggtactgaacgggccgaaaaaacac
gctaaagggtatatcgaagggctggaaatgctcgcctcgatgcgcctgtgcgcgaatgtg
cccgcacagcatgccattcagacggcgcttggcggttatcagagcattagcgaatttatc
gtgcctggcgggcggctttacgagcagcgcaaccgcgcgtgggagctgattaacgaaatt
ccaggcgttagctgcgttaaaccgcgcggcgcgctctacatgttcccgaaaattgacgca
aagcgttttaatattcacgacgatcagaaaatggtgctcgatttcctgcttcaggaaaaa
gtgctgctggttcagggcaccgcctttaactggccgtggccggatcacgtgcgtatcgtg
acgctgccgcgcatcgacgaactcgatcttgccatcacgaagctcggccgcttcctttcc
ggctaccatcagtaa

DBGET integrated database retrieval system