KEGG   Cronobacter sakazakii Sp291: CSSP291_07425Help
Entry
CSSP291_07425     CDS       T02461                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:csz00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1544034..1544639
Genome map
AA seq 201 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVYTAEIDDRFGAGKVSSRIGLSSPAR
LYNAHTSLFEDIRDAHQEAPVHCVLVDESQFLTRDQVYALSEVVDKLDIPVLCYGLRTDF
RGELFGGSQYLLAWSDKLVELKTVCFCGRKAGMVLRLDHEGRPYNEGEQVVIGGNERYVS
VCRKHYKEALEKGSLKAIQGR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaactttatttttactattcggcgatgaatgccggtaaatctacagcattactc
cagtcttcatataactaccaggaaaggggaatgcgtacccttgtttataccgcggaaatt
gatgatcgttttggcgcaggaaaggtgagttctcgtataggattatcctcgccagcaaga
ctttataatgcgcatacgtctttatttgaagatattcgcgatgcgcatcaggaagccccc
gttcattgcgtgctggtggatgaaagtcagtttctgacccgcgatcaggtttacgccctt
tctgaagtcgtcgataagctggatattcctgtgctctgttatggcctgcgtacggatttt
cgtggtgaactctttggaggaagccagtatttgctggcatggtctgacaaactggtagag
ctgaaaaccgtctgcttttgcggtcgtaaagcgggcatggtgctccgtctcgaccatgag
ggccggccttataatgaaggcgaacaggtcgtcattggtggcaatgagcgttatgtgtcg
gtgtgtcgtaagcattataaagaagccctggaaaagggctccctaaaagcgattcagggc
cgctaa

DBGET integrated database retrieval system