KEGG   Cronobacter sakazakii Sp291: CSSP291_07430Help
Entry
CSSP291_07430     CDS       T02461                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:csz00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CSSP291_07430
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSSP291_07430
   00620 Pyruvate metabolism
    CSSP291_07430
   00650 Butanoate metabolism
    CSSP291_07430
  Lipid metabolism
   00071 Fatty acid degradation
    CSSP291_07430
  Amino acid metabolism
   00350 Tyrosine metabolism
    CSSP291_07430
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CSSP291_07430
   00626 Naphthalene degradation
    CSSP291_07430
Enzymes [BR:csz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CSSP291_07430
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CSSP291_07430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1544998..1547676)
Genome map
AA seq 892 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYANFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILDEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASILMSKTF
DNGVICASEQSVIVVDSVYDAVRERFASHGGYLLQGAELKAVQNIILKNGALNAAIVGQP
AVKIAEMAGITVPSSTKILIGEVSLVDESEPFAHEKLSPTLAMYRAKDFEDAVEKAEKLV
AMGGIGHTSCLYTDQDNQPARVTFFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RAMIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSVVRKGAELMNSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDETGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKENLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEVAD
HLGLTAPGDRTAAKIEKLLAWLESIKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLIAELKQILLDSFYGREYKEGAEAVKAEAAPVAKADKKAKKTV
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaactaaacgccctcgtcgagcgcgtcaaaaaagcccag
cgtgaatatgccaacttcacccaagaacaggttgacaaaatcttccgcgccgccgctctg
gccgctgcagatgcccgaatccccctcgctaaaatggccgttgccgaatccggaatgggt
atcgtcgaagataaagtgatcaaaaaccactttgcttctgaatatatctacaacgcctat
aaagacgagaaaacctgcggcattctcgacgaagatgacacctttggtacgattaccatc
gctgaacctatcggcatcatctgcggtatcgttccgaccactaacccaacgtctaccgcc
attttcaaatcgcttatcagcctgaaaacccgtaacgcgatcattttctctccgcatccg
cgtgcgaaagatgcaactaataaggcagcggatatcgtgctgcaagccgctatcgctgca
ggcgcgccgaaagatctgatcggctggattgatcagccttccgttgagctgtctaacgcg
ctgatgcatcacccggatatcaacctgattctggccacgggtggcccgggcatggtgaaa
gcagcgtacagctccggtaaacctgctatcggtgtaggtgctggtaacacaccggtggtt
atcgacgaaacagccgatatcaaacgcgctgtcgcatctatcctgatgtctaagacgttt
gataacggcgttatctgtgcctctgaacagtctgtcatcgttgttgattctgtttatgat
gcggtgcgcgaacgtttcgcgagccacggcggctacctgctgcagggcgcggaactgaaa
gccgtgcagaatatcattctgaagaatggcgcgctgaacgcggctatcgtaggtcagccg
gcggtaaaaatcgccgagatggcaggcatcactgtgccgtccagcactaagatcctgatt
ggcgaagtctctctggtggatgaaagcgaaccgttcgctcatgagaaactctccccgacc
ctcgccatgtatcgcgcgaaagatttcgaagatgccgttgaaaaagcggaaaaactggtt
gcgatgggcggtatcggtcatacctcttgcctgtacaccgaccaggataaccaaccggct
cgcgtcactttcttcggcgataaaatgaaaaccgcgcgtatccttatcaacacgccggct
tctcagggtggtatcggggatctctacaacttcaagctggcgccgtctctgacgctgggt
tgcggctcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcataaacttccgaaatctatc
tacttccgtcgcggctcactgccgattgcgctggatgaagtgattactgatggtcacaaa
cgcgccatgatcgtgactgaccgcttcctgttcaacaacggttatgccgaccagatcact
tccgtactgaaagcggctggtgttgaaactgaagtgttctttgaagtagaagctgacccg
accctgagcgtggttcgcaaaggcgctgagctgatgaactcctttaaaccggacgttatc
atcgcgctcggtggtggctccccgatggatgccgcgaaaatcatgtgggtcatgtacgaa
catccggaaacccacttcgaagaactggcgctgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagcgaaaatgatcgccgtcaccaccacttccggt
accggttctgaagttacgccgtttgcggtggttaccgacgatgaaactggtcagaaatat
ccgctggcggactacgccctgaccccggatatggcgattgtcgatgccaacctggtgatg
gatatgccgaagtcactctgcgccttcggtggtctggatgcagtcactcacgcgctggaa
gcttacgtttctgtactggcatctgaattctccgatggtcaggcgcttcaggcactgaaa
ctgctgaaagaaaacctgccggcgtcttaccatgaaggttcgaaaaacccggttgcgcgt
gaacgtgttcacagtgctgccactatcgccggtatcgcgtttgcgaacgccttcctcggt
gtgtgtcactccatggctcacaaactgggttcacagttccacattccgcatggtctggcg
aacgccctgctgatttctaacgttatccgctataacgcgaacgataacccaaccaagcag
accgctttcagccagtatgaccgtccgcaggcgcgtcgccgttatgctgaagtggccgac
catctgggtctcactgcaccgggtgaccgtaccgcagcgaaaattgagaaactgctggct
tggctggaaagcatcaaagctgagctgggtattccgaaatctatccgtgaagcaggcgtt
caggaagccgacttcctggcccatgttgataaactgtctgaagatgccttcgatgaccag
tgtactggcgctaacccgcgctacccgctgattgccgagctgaaacagatcctgctggat
agcttctacggccgtgaatacaaggaaggtgctgaagctgtaaaagctgaagccgctcct
gtcgcgaaagctgataaaaaagccaagaaaacggtttaa

DBGET integrated database retrieval system