KEGG   Cronobacter sakazakii Sp291: CSSP291_07740Help
Entry
CSSP291_07740     CDS       T02461                                 

Definition
hypothetical protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:csz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CSSP291_07740
Enzymes [BR:csz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     CSSP291_07740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1613408..1615123
Genome map
AA seq 571 aa AA seqDB search
MENITPSTINLDAIKNLIARIYGDGFTTSHYETLEKHISETRKAITVPRKKGWDETDVVL
ITYADQFSAPGEKRLATFQRFFEKWLKPYFSHIHLLPFYPWSSDDGFSVVDYHRIDPQCG
DWGDIARLNTQARLMFDFVCNHISAQSEWFADYLAQKPGYEDFFIAVDPATDLSAVTRPR
ALPLLTPFTMQNGRVRHLWTTFSEDQIDLNFASPVVLLAMVDVLLHYLREGAQYVRLDAV
GFMWKTPGTSCIHLEKTHLLVKLFRAIADVVAPGTVIITETNVPHKDNIAYLGNGFDEAQ
MVYQFPLPPLVLHAIHTQNARTLCEWAQGLSDARIGETTWFNFLASHDGIGLNPLRGILP
EDAILRLVEDLQAQGARVNWKNNPDGTRSPYEINVTYMDALSLRDDSDATRLARFLLAHA
LLLTFPGVPAIYIQSILGSRNDEEGVERLGYNRAINRQKYTEAEMNTALQAEGNLRHETW
KQLGELISLRRQHAAFHPDSAFAARCINDAVLEIMRVADNGATVIALFNLSDTEQVIDYD
ARGCRELITGATINSDSLILAPWKAMWLSKA
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatataaccccttccacgataaatctcgacgcgattaaaaatctgattgcgcga
atttatggcgatggatttactacttcgcattacgaaacactcgaaaaacatatttcagaa
acgcgtaaagccattacagtgccgcgtaaaaaaggctgggatgaaaccgatgtggtatta
attacctatgccgatcagttcagcgcgcccggtgaaaaacgcctcgcgacttttcagcgt
ttttttgaaaagtggttaaaaccgtatttttctcatattcatcttttgccgttttatccc
tggtcgtctgacgacggattttcggtggtggattaccaccgcatcgacccacagtgcggc
gactggggcgatatcgcgaggcttaatacccaggcgcggctgatgtttgacttcgtctgc
aaccatatttccgcccagagtgaatggtttgcagattatctcgcgcaaaaaccgggctat
gaagatttctttattgccgttgacccggcgacggatttatccgccgtcacccggccgcgc
gcgttgccgttattaacgccgtttacgatgcaaaacggacgagtacgtcacctgtggacc
accttcagcgaagatcagattgacctcaatttcgccagcccggttgttctgctggcgatg
gtggatgtccttttgcattatctgcgcgaaggggcgcaatatgtccgcctcgacgccgtc
ggttttatgtggaaaacacccggaacgagctgtatccatctggaaaaaacacatctgtta
gtgaagctgttccgcgcgatcgccgatgtggtggctccgggcactgtgatcatcaccgaa
actaacgtaccgcataaagacaatatcgcctatctcggtaacgggtttgatgaggcgcag
atggtgtaccagttcccgctgccgccgctggtgctgcatgctattcatacccaaaatgcc
cgcacgctctgcgagtgggcgcaggggttaagtgacgcgcgtatcggtgaaaccacctgg
tttaatttcctggcgtcgcatgacggcatcgggcttaatccgctgcgcggcattcttccc
gaagacgcgattttacgcctggtggaagaccttcaggcgcaaggcgctcgggtcaactgg
aaaaataacccggacggcacgcgcagcccctatgaaattaacgtcacgtatatggatgcc
cttagtttacgggatgacagcgacgcgacgcgccttgcgcgttttctgctggcgcacgcg
ctgttattaaccttccccggcgttccggcgatttatattcaaagtattctcggctcgcgc
aatgatgaagagggcgttgaacggcttggctataaccgcgctattaatcgtcaaaaatat
accgaggcggaaatgaacacggcgctacaggccgaagggaatttacgccacgaaacgtgg
aagcaactcggcgagcttatttcgcttcgccgccagcacgcggcgtttcatcccgacagc
gcctttgccgctcgctgtattaatgatgcagtgctggaaattatgcgcgttgcagataat
ggcgcgacggttattgccctctttaatctcagcgataccgagcaggttattgattatgac
gcccgcggctgtcgtgaattaatcaccggtgcgacgataaatagtgactcgctgattctt
gccccatggaaagcaatgtggcttagcaaagcctga

DBGET integrated database retrieval system