KEGG   Cronobacter sakazakii Sp291: CSSP291_07865Help
Entry
CSSP291_07865     CDS       T02461                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
csz  Cronobacter sakazakii Sp291
Brite
Enzymes [BR:csz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     CSSP291_07865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1633033..1633518
Genome map
AA seq 161 aa AA seqDB search
MSPALKQRIVAAVGGGAIAIATAMVAGKDGLEGREYVPYRDVVGVLTVCDGHTGKDIIPG
KRYTDAECDALTQADMTHIARQIDPHIKVNTTDTQRAAIYSFAYNVGPSAAIKSTLMKKL
NDGDYVGACNELKRWIYAGGKKWRGLMSRREVEHQVCMWDR
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtccccggcattaaaacaacgaatcgtcgcagctgtgggcggtggggctattgccatt
gccaccgcaatggttgctggtaaagacggcttagaagggcgcgagtatgtgccttatcgg
gatgtggttggcgttcttacggtctgtgatggacataccggcaaagacattattccggga
aagcgttacaccgatgccgagtgtgatgcgcttacccaagctgatatgacacatatcgct
cgccagattgatccgcacatcaaagtaaacactactgatacccaacgcgccgctatctac
tcatttgcctataacgtcggcccctcagcagctatcaaatctactctgatgaaaaagctt
aacgacggtgattatgtcggggcatgtaacgagcttaagcgctggatttacgctgggggc
aagaagtggagagggttgatgagcaggcgagaagttgaacatcaggtttgcatgtgggat
cggtaa

DBGET integrated database retrieval system