KEGG   Cronobacter sakazakii Sp291: CSSP291_12210Help
Entry
CSSP291_12210     CDS       T02461                                 

Definition
acyl-CoA thioesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CSSP291_12210
   00500 Starch and sucrose metabolism
    CSSP291_12210
Enzymes [BR:csz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     CSSP291_12210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2553711..2555018
Genome map
AA seq 435 aa AA seqDB search
MNTFSVSRLALAFAFGVTLTACSSTPPDQRPSEQRAPGTSARPVLSADEAKNFVPARYFA
NIDPNAAPWAPSPIRLPEKADFVVGQAGEQGVTHTSIQAAVDAAIARHATARQYIAVLPG
TYEGTVYVPAAPGSVTIYGTGEKPLDVKISAALDSEMDANTWRRTVNPSGKYMPGKPAWY
MFDNCQNRRNGSVGLMCSAVFWSQNNGLQLQNLTIENSLGDAAGEGQHQAVALRTDGDRV
QINKVNVLGRQNPFLVTNSDIRNRFTPDRLTRTQVTNSYVEGDVDLVAGRGAVVFDNTEF
RVVNTRTQKEGYVFAPATMPNFYYGFLAVNSRFVAAGEGVAQLGRAWDMDAANGYTPGQT
PNGQVVIRDSVIDAGFNIAQPWGPALGSQRPFTGNTGAQDDKGNIQRDLNDANANRLWEY
NNRGLGSKVVAEPKK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
ttgaacacattttcggtttcccgtctggcgctggcgttcgcttttggcgtgacactgact
gcatgcagctcaacgccaccggaccaacgtccttctgaacaacgcgcgccgggtacgtcg
gctcgcccggtgctgtctgcggatgaagcgaaaaatttcgtcccggcccgctatttcgcc
aatatcgatccgaatgccgcgccgtgggcgccctccccgattcgactgcctgaaaaagca
gacttcgtggtcggccaggcgggcgagcagggcgtgactcacaccagcattcaggccgcc
gttgatgccgcgattgcgcgtcacgcgacggcgcgtcagtacatcgctgtactccccggc
acttacgaaggcaccgtttatgtgcctgccgcaccgggcagcgtgacgatttacggcacc
ggcgaaaaaccgctggatgtgaaaatcagcgccgcgctggacagcgaaatggatgccaac
acctggcgtcgtaccgtgaacccgtccggcaaatatatgcctggcaaaccggcctggtat
atgttcgataactgccagaaccgccgcaacggcagtgtcggcctgatgtgctccgcggtc
ttctggtcgcagaataatggcctgcaactgcaaaacctgaccattgaaaacagcctcggc
gacgccgcgggcgaaggtcagcaccaggctgtcgcgctgcgcaccgacggcgaccgcgtg
cagatcaacaaagtgaatgttctgggccgccagaatccgttcctggtgaccaacagcgat
attcgcaaccgcttcacgccggatcgtctgacccgcacgcaggtgacgaacagctacgtg
gaaggtgatgtggatctggtcgcgggccgcggcgcggtggtgtttgataacaccgaattc
cgcgtagtgaacacccgtacccagaaagaaggttatgtgtttgcgccagcgaccatgccg
aacttctattacggcttcctcgccgtgaacagccgctttgtcgcggccggtgaaggcgtg
gcgcagctcggccgcgcatgggatatggacgccgccaatggctatacgcctggccagacg
ccaaacggtcaggtcgtaatccgcgacagcgtgattgacgccggtttcaacatcgcgcag
ccgtggggcccggcgctgggctcacagcgtccgttcaccggcaacaccggcgcgcaggac
gacaaaggcaatatccagcgcgatctgaacgacgcgaacgccaaccgtctgtgggaatac
aacaaccgcgggctgggcagcaaagtggttgccgaaccgaaaaagtaa

DBGET integrated database retrieval system