KEGG   Cronobacter sakazakii Sp291: CSSP291_17395Help
Entry
CSSP291_17395     CDS       T02461                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:csz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CSSP291_17395 (hemD)
Enzymes [BR:csz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CSSP291_17395 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3699842..3700582
Genome map
AA seq 246 aa AA seqDB search
MTILVTRPSPAGEELVSRLRALGQEAWTFPLIEFCPGRELPQLPALLDALAPHDLLFALS
QHAVSFANAHLQRLGLRWPRAVEAFAIGRTTALALHQVSGLHVHYPRDREISEVLLQLPE
LQNVAGKRALILRGNGGRELLGETLTERGATVTFCECYQRSAKIYDGTEEAHRWHTRGIT
TLVVTSGEMLRQLHDLMPPWYRENWLLRCRLVVVSERLATIARELGWQNILVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacgattctggtcacccgcccctctcccgccggggaggaattagtgagccgcctgcgc
gcactggggcaggaggcctggacttttccgctgatcgagttctgccctggccgggagttg
ccgcagttgcccgcgctgctcgacgcgctcgcgccgcacgatctcctctttgcgctgtcg
caacacgcggtgagttttgcgaacgcgcatttacagcgtctggggctgcgctggcctcgc
gccgtcgaggcgttcgccatcgggcgtaccaccgcgctggcgctgcatcaggtcagcggt
ttgcacgtccattacccgcgcgatcgggaaatcagcgaagtcttgctacaattacctgaa
ttacaaaacgttgccggtaagcgtgcgcttatcctgcgcggcaacggcggacgcgaactg
ttaggggaaaccttaacggagcgcggcgcgaccgtgacgttttgcgaatgctatcaacgt
agcgcgaaaatttacgacggcaccgaggaagcgcaccgctggcatacgcgcggcattacc
acgctggtggtgacgagcggcgagatgctgcgccagctgcatgacctgatgccgccgtgg
tatcgcgaaaactggttgctgcgctgtcggctggtggtcgtcagcgagcgtctggcgacg
attgccagggagcttggctggcagaacattctggtcgctgataacgccgataacgacgcg
ctgctgcgcgcgttgcaataa

DBGET integrated database retrieval system