KEGG   Cronobacter sakazakii Sp291: CSSP291_17810Help
Entry
CSSP291_17810     CDS       T02461                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:csz00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CSSP291_17810
  Lipid metabolism
   00561 Glycerolipid metabolism
    CSSP291_17810
   00600 Sphingolipid metabolism
    CSSP291_17810
Enzymes [BR:csz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     CSSP291_17810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3809865..3811988)
Genome map
AA seq 707 aa AA seqDB search
METRIHRLTSLTTDVVIKTHPFAEILYWGPHLAHFSQQDCASLVRPVANGRLDTDSPVTL
MAENGHGLFGAPGLEGHRNGLDASPMFTTQDVNQNGQTLVITSEDATAGLRLVSELSLSD
SGVLKVRHGLTNLRDGAWQVDRFAVTLPVAERAFEVMAFHGRWIREFQPHRVTLSHDGFV
LENRRGRTSHEHFPALIAGTPGFGEQHGDVWGVHLGWSGNHRLKCEAKTDGRRYLQAEAL
YLPGEMALATGETLHTPWLYASHSTRGLNGMSQQFHRFLREEIIRFPGNKPRPVHLNTWE
GIYFDHQPEYIMQMATRAAALGVERFIIDDGWFKGRNDDHAALGDWYLDEQKYPDGLMPV
INHVKSLGMEFGIWVEPEMINPDSDLYRAHPDWVLALPGYPKTTGRHQWVLNLNISAAFD
YLLERMSWLLGEHPVDYVKWDMNRELVQPGHAGKAAADAQTRQFYRLLDVLRARFPHVEF
ESCASGGGRIDFEVLTRTHRFWASDNNDALERNTIQRGMSYFFPPEVMGAHIGNPRCHAT
FRQHSIEFRGLTALFGHMGLELDPVSAGEQEAAGYQRYAALYKEWRELIHTGDLWRVEMP
DAATQVQGVVSQDKTQGLFLVSQLAMPDYTLPGALRVPGLDPQARYQVRLVDHPNIQLTG
EGGHTMRKLPGWMSEPVSASGEWLAQAGLQLPVLDPETAMLIAFERV
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggaaacccgcattcatcgactcaccagcctcacaaccgatgttgttatcaaaacgcac
ccgttcgctgaaattctctactgggggccgcatctggcgcacttttcgcagcaggattgt
gcgagcctcgtgcgcccggtggctaatggccgtctggataccgattcacccgtcacgtta
atggcggagaacggccacgggctgtttggcgcgccggggctggaagggcaccgcaacggg
ctggacgcctcgccgatgtttaccacgcaggacgtcaaccagaacgggcagacgctggtg
attaccagtgaagacgccaccgccgggctgcggctcgtgagcgagctttcgctcagcgac
agcggcgtgctgaaagtgcgccacggcctgaccaatctgcgcgacggcgcctggcaggtg
gatcgtttcgcggtcacgctgccggtggcggagcgggcgtttgaagtgatggcgtttcat
ggccgctggatacgtgagttccagccgcaccgcgtgacgttaagccatgatggctttgtg
ctggagaaccgccgcgggcgcacctcgcacgagcatttcccggcgcttatcgccggtacg
ccgggttttggcgagcagcacggcgacgtctggggcgtgcatcttgggtggagcggcaac
caccggctgaagtgcgaagcgaaaaccgacgggcggcgctatctccaggccgaggcgctc
tatctgccgggcgaaatggcgctggcgaccggcgagacgctgcacacgccctggctctac
gcaagccactccacgcgcggtctgaacggcatgagccagcagtttcaccgctttctgcgt
gaggaaatcatccgttttcctggcaacaaaccgcgcccggtgcacctcaacacctgggag
gggatctacttcgaccatcagccggaatacatcatgcagatggcgaccagggccgcggcg
ctcggtgtggagcgctttatcattgacgacggctggtttaagggccgcaacgacgaccac
gcggcgctcggcgactggtatctcgatgagcagaaatacccggacggcctgatgccggtg
attaatcacgtgaaaagtctcgggatggagttcggcatctgggtggagccggagatgatc
aaccccgattccgatctttaccgcgcgcacccggactgggtgctggcgctgccgggctac
ccgaaaaccaccggacgccatcagtgggtgcttaatctcaacatttctgccgccttcgat
tacctgctggaacgcatgagctggcttctgggcgagcatccggttgattacgtgaagtgg
gacatgaaccgcgagctggtgcagccgggccacgcgggcaaagcggcggcagacgcccag
acgcgtcagttctatcgcctgctggatgtgctgcgcgcgcgtttcccgcacgttgaattt
gagtcctgcgcgtccggcggcgggcgtatcgatttcgaagtgctgacgcgcacgcaccgc
ttctgggcctccgacaacaacgacgcgctggagcgcaacaccatccagcgcggcatgagc
tacttcttcccgccggaagtgatgggcgcgcatatcggcaacccgcgctgccatgcgacg
ttccgccagcacagcattgagtttcgcggcctgacggcgctgttcggtcatatgggcctg
gagctggacccggtcagcgctggcgagcaggaggcggcgggctatcagcgctatgccgcg
ctttataaggaatggcgtgagctgatccacaccggagacctgtggcgcgtagagatgccg
gacgccgccacgcaggtgcagggcgtcgtcagtcaggataagacgcaggggctgtttctg
gtaagccagctggcgatgccggattacacgctgccaggcgcgctgcgcgtgccggggctc
gatccgcaggcccgttaccaggtgcggctggtggatcatccgaatattcagttgaccggc
gaaggcggccacaccatgcgcaaactgccgggctggatgagcgagcctgtcagcgccagc
ggcgaatggctggcgcaggcggggctgcaactgccggtgctcgacccggaaactgcgatg
cttatcgcgtttgagcgcgtgtaa

DBGET integrated database retrieval system