KEGG   Cronobacter sakazakii Sp291: CSSP291_18665Help
Entry
CSSP291_18665     CDS       T02461                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:csz00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CSSP291_18665
Enzymes [BR:csz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CSSP291_18665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3988036..3988965
Genome map
AA seq 309 aa AA seqDB search
MKSAGQLVVLGSINADHILNLEAFPAPGETVTGSQYQVAFGGKGANQAVAAGRSGADIAF
IACVGEDDIGERIRQQLSLDNIDVAPVSAVAGESTGVALIFVNGEGENVIGIHAGANAAL
TPERVNQQREKIANARALLMQLESPVESVIAAARIAHENQTTMILNPAPARALSDDLLAL
VDIITPNETEAEKLTGVKVSDDESAAQAAAVLHQKGIETVIITLGSRGVWLSVNSEGQRV
PGFRVKAVDTIAAGDTFNGALMTALLEGTPMLEAIRFAHAAAAIAVTRPGAQPSVPWRDE
IDAFLQAQG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcgcgggccaactcgtcgttctcggcagtatcaatgccgatcatatccttaac
cttgaagccttccccgcgccgggcgagactgtcaccggcagccagtatcaggtggcgttc
ggcggtaaaggggccaaccaggccgtcgcggccgggcgcagcggcgcggatatcgcgttt
atcgcctgtgtgggtgaggatgatatcggcgagcgtatccgccagcagctttcactcgac
aacatagatgtcgcgcctgtcagcgccgttgcgggcgaatcgaccggcgtggcgctgatt
ttcgttaatggcgaaggtgaaaacgtgatcggcattcacgctggcgcgaacgcggcgttg
acgcccgagcgcgttaaccaacagcgggagaaaatcgccaacgcccgcgcgctgctgatg
cagctggagtcgccggtagaaagcgttatcgcggccgcgcgcattgcgcatgaaaatcag
accaccatgattcttaacccggcccctgcccgcgcgctttctgacgatctgctggcgctg
gtggatatcattacccccaatgaaactgaagcggaaaaactgacgggcgtgaaagtctct
gatgatgagagtgccgcgcaggccgcggcggtgctgcatcaaaaaggcattgaaacggtc
attattacgctcggcagccgcggcgtgtggctgagcgttaacagcgaagggcaacgcgtg
cccggctttcgcgtcaaagccgtcgataccatcgccgctggcgatacttttaacggcgcg
ctgatgacggcgctgctggaaggcacgccgatgcttgaagccattcgttttgctcatgcg
gccgcggctatcgccgtgacgcgccctggcgcgcagccttctgtgccgtggcgcgatgag
attgacgccttcttacaggcgcaggggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system