KEGG   Cronobacter sakazakii Sp291: CSSP291_19280Help
Entry
CSSP291_19280     CDS       T02461                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:csz00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:csz00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4121407..4122729
Genome map
AA seq 440 aa AA seqDB search
MPTYFDQLERVRYEGPKTTNPLAFRHYNPDELVAGKRMEDHLRFAACYWHTFCWNGSDMF
GVGAFERPWQQAGDALSLAKRKADVAFEFFHKLNVPYYCFHDVDVSPEGASLKEYLNNFA
QMVEVLAQKQQESGVKLLWGTANCFTHPRYGAGAATNPDPEVFSWAAAQVVTAMNATHQL
GGENYVLWGGREGYETLLNTDLRQEREQLGRFMQMVVEHKHKTGFRGTLLIEPKPQEPTK
HQYDYDAATVYGFLKQFGLEKEIKLNIEANHATLAGHSFHHEIASAIALGLFGSVDANRG
DPQLGWDTDQFPNSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALSLKVAAKMLEEGELDKRVARRYAGWNGELGQQILKGQMTLAELAQYAEQHNLAPQ
HQSGHQEQLENLVNYYLFDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgccgacttatttcgaccaacttgaacgtgtgcgttatgaaggcccgaaaaccacgaat
cccctggcattccgccattacaatcctgacgagttggttgccggcaagcgtatggaagac
catctgcgtttcgctgcctgctactggcacacgttctgctggaacggctcggatatgttt
ggtgttggcgcgtttgaacgcccgtggcagcaagcaggggacgcgctgagcctcgcgaaa
cgcaaagccgacgtggcctttgagtttttccacaagctcaacgtgccttactactgcttc
catgacgttgacgtatcgccggaaggcgcgtcgctgaaggagtacctgaacaacttcgcc
cagatggtagaagtgctggcgcagaagcaacaagagagcggcgtgaagctgctgtggggc
accgccaactgctttacccacccgcgctacggcgcaggcgccgccaccaaccctgatccg
gaagtcttctcctgggcggccgcgcaggtggtcaccgccatgaacgcgacacatcaactg
ggcggtgaaaactatgtgctgtggggcggacgtgaaggctacgaaacgctgctcaacacc
gatctgcgccaggagcgtgaacagcttggtcgctttatgcagatggtggtcgagcataaa
cataaaaccggctttcgcggtacgctgcttatcgagccaaaaccgcaggaaccgaccaaa
catcagtacgactacgacgcggcgaccgtgtatggcttcctgaaacagttcggccttgag
aaagagattaagcttaacattgaggccaaccacgctacgcttgcgggccattctttccac
catgagattgccagcgccatcgcgcttggtctgtttggctcggtggatgcgaatcgcggt
gacccgcaactcggctgggataccgatcagttcccgaacagtgtcgaagagaacgccctg
gtgatgtatgaaatcctcaaagcgggcggcttcacgaccggtgggctgaattttgacgcc
aaagtgcgccgtcagagcaccgataaatatgacctgttctatggtcatatcggcgcgatg
gatacgatggcgctgtcgctgaaagtcgcggcgaaaatgctcgaagagggcgaactggat
aaacgtgtcgcccgccgttatgccggctggaacggcgagcttggtcagcaaatcctgaaa
gggcagatgacactggctgaactggcgcaatacgccgagcagcataatctggcaccgcag
catcagagcggacatcaggaacagctggaaaacctggtaaattattatctgtttgataag
taa

DBGET integrated database retrieval system