KEGG   Cronobacter sakazakii Sp291: CSSP291_19490Help
Entry
CSSP291_19490     CDS       T02461                                 

Definition
(GenBank) endo-1,4-D-glucanase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
csz  Cronobacter sakazakii Sp291
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
4166179..4167294
Genome map
AA seq 371 aa AA seqDB search
MKNLCRWLAAGLLLATVSAHAACGWADWDRFKGGYISEEGRVIDPSDPRKITTSEGQSYA
LFFALAANDREAFDNILQWTENNLAQGSLKNTLPAWLWGMKGPDEWTVLDTNSASDADLW
IAWSLLEAGRLWKEPRYSDTGKALLDRIAKEEVVNVPALGDMLLPGKVSFAEPTLWRFNP
SYMPPQLARYFTRYGKPWTTIRDTNLRLLLETAPQGFSPDWVSYEAKKGWVMKPAAPQKP
LIGSYDAIRVYLWVGMMNPADEQQAPLLKKLSPMETATIKAGVPPEKVRVIDGKTQGNGP
VGFSAALLPFLQNRDIQALQRQRVADNYPQQDAYFSYVLTLFGQGWDEHRFRFTVDGELQ
PAWGESCTSSR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatctgtgcagatggcttgcggcggggctgctgctggcgaccgtttcagcccat
gccgcctgtggctgggctgactgggaccgctttaaaggcggctatatcagcgaagaagga
cgcgtgattgacccaagcgatccgcgcaaaatcacgacgtccgaagggcagagctacgcg
ctgttcttcgcccttgcggccaacgaccgcgaggcgttcgataacattcttcagtggacg
gaaaataaccttgcgcaaggctcgctaaaaaatacgctgcctgcctggctgtggggcatg
aaagggccggacgaatggacggtgctcgacaccaattccgcttccgacgccgatctgtgg
atagcctggagcctgcttgaagcgggacgcttgtggaaagagccgcgctacagcgacacc
ggcaaagcgctgctggaccgcatcgccaaagaagaagtggtgaacgtgcccgcgcttggc
gacatgctgctgccgggtaaagtgagctttgccgagccgacgctctggcgctttaacccg
agctatatgccgccgcagctggcgcgctatttcacccgttacggcaaaccctggacaacc
atccgcgataccaacctgcgcctgctgctggaaacggccccgcagggcttttcgccggac
tgggtgagctacgaggcgaagaaaggctgggtgatgaaacctgcggcaccgcaaaaaccg
ctgattggcagctacgatgccattcgcgtttatctgtgggtcggcatgatgaacccggcg
gatgaacagcaggcgccactgctcaaaaaactcagcccgatggaaaccgccacaatcaaa
gcgggcgtgccgccggaaaaagtccgtgttatcgacggtaaaacccagggtaacgggccg
gtgggcttttccgccgcgctgctgccgttcctgcaaaaccgcgatatccaggcgctgcaa
cgccagcgcgtggcggataactatccgcagcaggacgcctactttagctatgtattaacc
ctgtttggccagggatgggatgaacaccgtttccgcttcaccgttgacggtgagctgcaa
cccgcctggggagagtcatgcacaagttcgcgttaa

DBGET integrated database retrieval system