KEGG   Cronobacter sakazakii Sp291: CSSP291_19490Help
Entry
CSSP291_19490     CDS       T02461                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CSSP291_19490
Enzymes [BR:csz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CSSP291_19490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4166179..4167294
Genome map
AA seq 371 aa AA seqDB search
MKNLCRWLAAGLLLATVSAHAACGWADWDRFKGGYISEEGRVIDPSDPRKITTSEGQSYA
LFFALAANDREAFDNILQWTENNLAQGSLKNTLPAWLWGMKGPDEWTVLDTNSASDADLW
IAWSLLEAGRLWKEPRYSDTGKALLDRIAKEEVVNVPALGDMLLPGKVSFAEPTLWRFNP
SYMPPQLARYFTRYGKPWTTIRDTNLRLLLETAPQGFSPDWVSYEAKKGWVMKPAAPQKP
LIGSYDAIRVYLWVGMMNPADEQQAPLLKKLSPMETATIKAGVPPEKVRVIDGKTQGNGP
VGFSAALLPFLQNRDIQALQRQRVADNYPQQDAYFSYVLTLFGQGWDEHRFRFTVDGELQ
PAWGESCTSSR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatctgtgcagatggcttgcggcggggctgctgctggcgaccgtttcagcccat
gccgcctgtggctgggctgactgggaccgctttaaaggcggctatatcagcgaagaagga
cgcgtgattgacccaagcgatccgcgcaaaatcacgacgtccgaagggcagagctacgcg
ctgttcttcgcccttgcggccaacgaccgcgaggcgttcgataacattcttcagtggacg
gaaaataaccttgcgcaaggctcgctaaaaaatacgctgcctgcctggctgtggggcatg
aaagggccggacgaatggacggtgctcgacaccaattccgcttccgacgccgatctgtgg
atagcctggagcctgcttgaagcgggacgcttgtggaaagagccgcgctacagcgacacc
ggcaaagcgctgctggaccgcatcgccaaagaagaagtggtgaacgtgcccgcgcttggc
gacatgctgctgccgggtaaagtgagctttgccgagccgacgctctggcgctttaacccg
agctatatgccgccgcagctggcgcgctatttcacccgttacggcaaaccctggacaacc
atccgcgataccaacctgcgcctgctgctggaaacggccccgcagggcttttcgccggac
tgggtgagctacgaggcgaagaaaggctgggtgatgaaacctgcggcaccgcaaaaaccg
ctgattggcagctacgatgccattcgcgtttatctgtgggtcggcatgatgaacccggcg
gatgaacagcaggcgccactgctcaaaaaactcagcccgatggaaaccgccacaatcaaa
gcgggcgtgccgccggaaaaagtccgtgttatcgacggtaaaacccagggtaacgggccg
gtgggcttttccgccgcgctgctgccgttcctgcaaaaccgcgatatccaggcgctgcaa
cgccagcgcgtggcggataactatccgcagcaggacgcctactttagctatgtattaacc
ctgtttggccagggatgggatgaacaccgtttccgcttcaccgttgacggtgagctgcaa
cccgcctggggagagtcatgcacaagttcgcgttaa

DBGET integrated database retrieval system