KEGG   Cronobacter sakazakii Sp291: CSSP291_19910Help
Entry
CSSP291_19910     CDS       T02461                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CSSP291_19910 (malQ)
Enzymes [BR:csz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CSSP291_19910 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4266786..4268894
Genome map
AA seq 702 aa AA seqDB search
MESKRLDSSALAAGISPNYINAHGKPQAIGAETKRRLLEAMNPEAAPKAADKSPLPPVKV
VAKSRRMQLTPQGRGDYHWLLTSETGEQFSGNARGGEALTLPAKLDEGYHTLTLTRDDSR
WHCRLIVAPKRCYEPQALREGKKLWGACVQLYTLRSQNNWGIGDFGDLQAMLNEVGPRGG
AFIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFRRSDEAQAWWKLKSTQQ
ALKAARESQWVDYSTVTMLKLTALKMAWARFSTRGPDDDDVVAFRDFVARAGESLYWQAA
FDAIHAWQAQEDPMRWGWPAWPKAYQNTSSPEVQAFCKNRADEVDFYLWLQWLAYEQFAR
CWETSQSHDMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPP
MDPHVMQARAYEPFIELLRANMTNCGALRIDHVMSLLRLWWIPYGETADKGAYVQYPVDD
LLAILALESQRHRCMVIGEDLGTVPAEIVGKLRDSGVYSYKVLYFENEGGSRFRAPKRWT
SQAMAVATTHDLPTLRGYWESGDLTLGKTLGLYPDEEVLKGLYADRERAKQGLLESLHQH
GCLPKRAGHHAARMKMGATLNRALQRYIADSNSALLGLQPEDWLDMAQPVNVPGTSDQYK
NWRRKLTVGLEAMFADDTVNRLIKDLDKRRRAASAVKPAKRK
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaacgccttgactcctccgcccttgcggcggggattagccctaactacatc
aatgcgcacggcaaaccgcaggcgattggcgctgagaccaaacggcgtttgctggaagcg
atgaacccggaggccgcgccgaaagcggccgataaatcgccgctgccgccggtaaaagtg
gtggcgaagagccgccgtatgcagttaacgccgcagggccgcggcgattaccactggctg
ctcaccagcgaaaccggcgagcagtttagcggcaacgcgcgcggcggcgaggcgctgacg
ctgccggcgaagcttgacgaggggtatcacacgctgacgctcacgcgtgacgacagccgc
tggcactgtcggcttattgtcgcgccgaagcgctgctatgagccgcaggcgctgcgtgag
ggtaaaaaactctggggcgcgtgcgtccagctttatacgctgcgctcgcaaaataactgg
ggcattggggatttcggcgatctgcaagcgatgctgaatgaagtgggcccgcgcggcggc
gcgtttatcggtttaaacccgattcacgcgctttatccggcgaacccggagagcgcgagc
ccgtacagtccgtcttctcgccgctggcttaacgtcatttatatcgacgtgaacgcggtg
gaggatttccggcgcagcgatgaggcgcaggcgtggtggaagcttaagtccacccagcag
gcgctgaaagcggcccgggagtcgcagtgggtcgattattcgaccgtgaccatgctcaag
ctcaccgcgctgaaaatggcctgggcgcgcttctccacgcgtggcccggatgatgacgat
gtggtggcgtttcgcgatttcgtggcgcgcgcgggcgaaagcctctactggcaggcggcg
ttcgacgccatccacgcctggcaggcgcaggaggatccgatgcgctggggctggcccgcc
tggccgaaagcgtatcagaacaccagcagcccggaagtgcaggcgttttgtaaaaaccgc
gctgatgaggtcgatttctacctctggctgcaatggctcgcgtatgagcagtttgcccgc
tgctgggagaccagccagtcgcacgacatgccgatcgggctgtatcgcgatctggcggtc
ggtgtggcggaaggcggcgcggaaacctggtgcgaccgcgagctgtactgtctgaaagcg
tctgttggcgcgccgccggatattctggggccgctcggtcagaactggggcctgccgccg
atggatccgcacgtgatgcaggcgcgcgcttacgagccgtttatcgagctgctgcgcgcc
aatatgacgaattgcggcgcgctgcgcatcgaccatgtgatgtcgctgctgcgcctgtgg
tggatcccgtatggcgaaacggcggataaaggcgcttatgtgcagtatccggtcgacgat
cttctggcgatcctcgcactcgaaagccagcgccaccgctgcatggtgatcggcgaagat
ctcggtacggttccggcggaaatcgtcggcaagctacgcgacagcggcgtctattcgtac
aaagtgctttactttgaaaacgaaggcggcagccgcttccgcgcgccgaagcgctggacg
tcgcaggcgatggcggtcgcgaccactcacgatctgcccacgctgcgcggctactgggaa
agcggcgatttaacgctcgggaaaacgctggggctctatcccgacgaagaggtactaaaa
gggctatacgccgatcgtgagcgggccaaacaggggctgctggagagcctgcaccagcat
ggctgcctgccgaaacgcgcagggcatcacgccgcgcgcatgaaaatgggcgccacgctt
aaccgcgcgctccagcgctatatcgccgacagcaacagcgcgctgctcggtctgcagccg
gaagactggctggatatggcgcagccggtcaacgtgccgggcaccagcgaccagtataaa
aactggcggcgcaagctcaccgtcgggctggaggcgatgtttgctgatgacaccgtgaac
cggttgattaaagatctggataaacgtcgccgcgccgcgtcggcggttaagccagcaaaa
cgtaagtaa

DBGET integrated database retrieval system