KEGG   Chlamydia trachomatis A/HAR-13: CTA_0076Help
Entry
CTA_0076          CDS       T00280                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cta  Chlamydia trachomatis A/HAR-13
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cta00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CTA_0076 (dxr)
Enzymes [BR:cta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     CTA_0076 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
84526..85665
Genome map
AA seq 379 aa AA seqDB search
MKHLALIGSTGSIGRQVLQVVRSIPDTFIIETLAAYGRNQEALISQIREFNPRVVAVREE
TTYKELRKLFPHIEILLGEEGLVSVATEPSVTMTIVASSGIDALPAVIAAIRQKKTIALA
NKESLVAAGELVTTLARENGVQILPIDSEHNALFQCLEGRDSSTIKKLLLTASGGPLRNK
SKEELQKVSLQEVLRHPVWNMGPKITVDSSTLVNKGLEIIEAFWLFGLEAVEIEAVIHPQ
SLVHGMVEFCDGTILSVMNPPSMLFPIQHVLTFPERSPAIGPGFDFLSNRTLEFFPIDED
RFPSVHLAKRVLLEKGSMGCFFNGANEALVHRFLAGEISWHQIVPKLQALVDQHRVQSCL
SLEEILSVDAEARARAQEC
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcatttagcactgatagggtcaacagggagtattggtagacaggttttacaagta
gttcgttctattcccgatacttttattatagaaactcttgctgcgtatggacggaatcaa
gaagcattgatttctcagattagagagtttaatcctcgcgtggtagccgttcgtgaagaa
acaacttacaaggagctccgtaagttattccctcatattgagattcttttaggagaagag
gggttagtttctgttgctacagaaccttctgtaacaatgaccattgtagcttcgtctggt
atagatgctttaccagcagtcattgcagctatccgacagaaaaagacaatagctttggct
aataaagagtcgttagtggcagctggagagttggttaccactttggctagagagaatggt
gtgcagattcttcccatcgatagtgaacataacgcacttttccagtgcttagaaggaaga
gactcttctaccattaaaaaattattgttaacagcttctggagggccgttaaggaataaa
tcaaaagaagaattacaaaaggtctctttacaagaggtcttgcgacaccctgtttggaat
atggggcccaaaattacagtagattcttctaccttagtaaataaaggcttagaaattata
gaagctttctggctatttgggctggaagctgtagagatagaggcggtgatccatcctcaa
agtcttgttcatggaatggtggagttttgtgatggaacgatcctttctgtgatgaatcct
cccagtatgctatttccaatacaacatgttttgactttcccagaacgtagccctgcaata
ggtccaggattcgattttctttcaaatcgcactctagagtttttcccgatagatgaagat
agattccctagtgttcatctagcaaagcgagtgcttcttgaaaaggggtctatggggtgt
tttttcaatggcgccaatgaggctttggttcatcgatttttagcaggcgagatttcttgg
catcaaatagttcctaaattacaagctcttgtggatcagcatcgcgtgcaatcctgttta
tccctggaagaaattctatcggtagatgctgaggccagagctcgtgctcaagagtgttaa

DBGET integrated database retrieval system